KEGG   Rhodococcus opacus PD630: Pd630_LPD03386
Entry
Pd630_LPD03386    CDS       T03071                                 

Definition
(GenBank) Regulatory protein recX
  KO
K03565  regulatory protein
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03386
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pd630_LPD03386
SSDB
Motif
Pfam: RecX
Other DBs
NCBI-ProteinID: AHK30605
LinkDB
Position
3582514..3582939
AA seq 141 aa
MAERLAKKGYSPEIAERVLDRLTEVGLVNDADFAQQWVHSRHTYSGKGKRALALELRRKG
IGQEDATEALAQIDSEDERARATELVAKKLRTVSADDRDRAVRRLVSMLARRGFPQGMAF
EVVKEQLDRAGAETDGLFDET
NT seq 426 nt   +upstreamnt  +downstreamnt
ttggccgagcgtctggcgaaaaagggctactcgcccgagatcgctgagcgtgtgctggat
cgtctcaccgaggtcggactcgtcaacgacgccgacttcgcccagcaatgggtgcattcg
cggcacacgtactccggcaaggggaaacgtgcgctcgcactggaactgcgccgcaagggc
atcggtcaggaagacgccaccgaggcgctcgctcagatcgacagcgaagacgaacgagcg
cgagccaccgaactggtcgcgaagaaactgcggacggtgtccgcggacgatcgggaccgt
gcggtccgccgcctggtgtcgatgctcgcgcgccgcggattcccccagggcatggcgttc
gaggtggtcaaggaacaactcgatcgcgcgggtgcggaaaccgatggcctgttcgacgag
acctga

DBGET integrated database retrieval system