KEGG   Rhodococcus opacus PD630: Pd630_LPD03478Help
Entry
Pd630_LPD03478    CDS       T03071                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00071  Fatty acid degradation
roa00280  Valine, leucine and isoleucine degradation
roa00281  Geraniol degradation
roa00362  Benzoate degradation
roa00592  alpha-Linolenic acid metabolism
roa01100  Metabolic pathways
roa01110  Biosynthesis of secondary metabolites
roa01120  Microbial metabolism in diverse environments
roa01130  Biosynthesis of antibiotics
roa01212  Fatty acid metabolism
Module
roa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pd630_LPD03478
   00592 alpha-Linolenic acid metabolism
    Pd630_LPD03478
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pd630_LPD03478
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Pd630_LPD03478
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pd630_LPD03478
   00642 Ethylbenzene degradation
    Pd630_LPD03478
Enzymes [BR:roa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Pd630_LPD03478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHK30697
UniProt: W8GY85
LinkDB All DBs
Position
complement(3678620..3679828)
Genome map
AA seq 402 aa AA seqDB search
MAPSTTTQRNVVFVDGIRTPFGKAGPKGIYAETRADDLVVKTIRELLRRNPQLDPARIDE
VAIAATTQTGDQGLTIGRTSAILAGLPETVPGFAIDRMCAGAMTSVTTTASGIGFGQYDV
VIAGGVEHMGRHPMGEGADPNPRFLADRLVDPSALVMGNTAENLHDRFPTITKDRTDAYA
VASQNKYEAARKAGFIADTLVPVATRSAAGWGLATEDEPPRPGTTLEDLGKLKTPFRPAG
RITAGNAAGLNDGATAALLAGEDTALELGLPIGMRMVGFAFQGVDPAVMGIGPVPATEKL
LARTGLKIEDIGLFEINEAFAVQVLAFLEHYGIADDDPRVNQWGGAIACGHPLASSGVRL
MTQLSRQFAQRPDVRYGLTTMCIGLGMGGTVIWENPNFDGAK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtggctccatccaccacaactcaacgcaacgtcgtgttcgtcgacggcatccgcactccg
ttcggcaaggccggccccaagggcatctacgcggagacccgcgcggacgacctcgtcgtc
aagaccatccgcgagctgcttcgccgtaatccgcagctcgaccccgcgcgcatcgacgag
gtcgccatcgccgcgaccacgcagacgggcgatcagggtctcaccatcggccgcacctcc
gcgatcctggccggacttcccgagaccgtccccggtttcgccatcgaccgcatgtgtgcc
ggtgccatgacgtccgtcaccaccaccgcgtcgggcatcggcttcggccagtacgacgtg
gtgatcgccggcggcgtcgagcacatgggccgtcacccgatgggcgagggcgcagacccg
aacccccggttcctcgccgatcgcctcgtcgaccccagcgcgctcgtcatgggcaacacg
gccgagaacctgcacgaccggttcccgaccatcaccaaggaccgcaccgacgcgtacgcc
gtcgcgagccagaacaagtacgaggccgcccgcaaggccggcttcatcgccgacaccctc
gtgcccgtcgccacccgctccgccgccggctgggggctggccaccgaggacgagccgccg
cgtccgggcaccacgctcgaggacctcggcaagctgaagacgccgttccgtcccgcgggt
cggatcaccgcgggtaacgcggccggtctgaacgacggtgcgaccgccgccctcctcgcc
ggtgaggacaccgcgctcgaactcggactgccgatcggcatgcgcatggtcggattcgcg
ttccagggcgtcgaccccgcagtcatgggcatcggcccggtgccggccaccgagaagctg
cttgcccgcaccggcctgaagatcgaggacatcggtctgttcgagatcaacgaggccttc
gccgtccaggtcctcgcgttcctcgagcactacggcatcgccgacgacgatccgcgcgtc
aaccagtggggcggcgccatcgcatgcggccaccccctcgcgtcctccggtgtccgcctg
atgacccagctgtcccgccaattcgcccagcgccccgacgtccgttacggcctgaccacc
atgtgcatcggtctgggcatgggcggaaccgtgatctgggagaacccgaacttcgatgga
gccaagtag

DBGET integrated database retrieval system