KEGG   Rhodococcus opacus PD630: Pd630_LPD03518
Entry
Pd630_LPD03518    CDS       T03071                                 

Definition
(GenBank) Crossover junction endodeoxyribonuclease ruvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD03518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03518
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     Pd630_LPD03518
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD03518
    RecFOR pathway proteins
     Pd630_LPD03518
SSDB
Motif
Pfam: RuvC
Other DBs
NCBI-ProteinID: AHK30731
LinkDB
Position
3714578..3715147
AA seq 189 aa
MRVLGVDPGLTRCGFGVVDGGSGRTVTPIAVDVVRTPADLELASRLLRISEAAESWIDLH
RPEVVAIERVFSQHNVRTAMGTAQAGGVVALAAARRGIPVCFHTPSEVKAAVTGSGSADK
AQVTAMVTRILKLAAAPKPADAADALALAICHCWRAPMIERMARAEAAAAEQKRRYQARL
AEVKKAGTR
NT seq 570 nt   +upstreamnt  +downstreamnt
gtgcgtgtgctgggtgtggatcccggtctgacccggtgcggattcggagtggtggacggc
ggcagcggccgcaccgtcaccccgatcgccgtcgacgtggtccggaccccggcagacctc
gagttggcgtccaggctgttgcgcatctccgaggcggccgaatcgtggatcgatctgcac
cggcccgaggtcgtggcgatcgagcgggtgttctcccagcacaacgtgcgcaccgcgatg
ggcaccgcgcaggcgggtggcgtcgtcgccctcgccgccgcgcgccgcggcatccccgtg
tgtttccatacccccagtgaggtcaaggccgcagtcaccgggagtggctccgccgacaaa
gctcaggtgacggcgatggtgacgcgcatcctcaaactggcggccgcacccaaaccggcc
gacgcggcggacgcgctggcgctggcgatctgccattgctggcgggcgccgatgatcgaa
cgcatggcccgcgccgaagccgccgccgccgaacagaaacgtcgctaccaggcccgactg
gccgaagtgaagaaggcaggtacacgatga

DBGET integrated database retrieval system