KEGG   Rhodococcus opacus PD630: Pd630_LPD03519
Entry
Pd630_LPD03519    CDS       T03071                                 

Definition
(GenBank) Holliday junction ATP-dependent DNA helicase ruvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD03519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03519
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pd630_LPD03519
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD03519
    RecFOR pathway proteins
     Pd630_LPD03519
SSDB
Motif
Pfam: RuvA_N HHH_5 RuvA_C
Other DBs
NCBI-ProteinID: AHK30732
LinkDB
Position
3715144..3715746
AA seq 200 aa
MIASVRGEVLEIALDHAVIESAGVGYRVNATPATLGALQRGTEARLVTAMIVREDSMTLY
GFPDSESKELFGLLQTVSGVGPRLAMATLAVLEPDALRAALAEGNVTALTRVPGIGKRGA
ERMVVELRDKVDAVASTSGAVPLGAGGGGSVRDQIVEALVGLGFPAKQAEQATDAVLAEA
PESTTSSALRSALSLLGKTR
NT seq 603 nt   +upstreamnt  +downstreamnt
atgatcgcgtccgtccgcggcgaggtgctcgagatcgccctcgaccatgcggtgatcgaa
tccgccggagtgggataccgcgtgaacgcgacgccggccaccctcggcgcactgcagcga
ggaaccgaggccaggctggtcacggcgatgatcgtccgcgaggactcgatgacgctgtac
gggttccccgactcggagtccaaggagttgttcgggctgctccagaccgtgtccggagtc
ggcccgcgcctggcgatggcgaccctggccgtgctcgaacccgacgcgttgcgggcggca
ctggccgagggcaacgtcacggcgctcacgcgggtgccgggcatcggcaagcgcggggcg
gagcggatggtcgtcgaactgcgcgacaaggtcgacgccgtcgcgtccacgtccggggcg
gtgccgctcggtgcgggcggcggcggatcggtccgtgaccagatcgtcgaagccctggtc
gggctcggattcccggccaagcaggcggaacaggccaccgacgccgtcctcgccgaggcg
cccgagtcgaccacctcgtccgcgctgcgctccgccctctccctgctcgggaagaccaga
tga

DBGET integrated database retrieval system