KEGG   Rhodococcus opacus PD630: Pd630_LPD03903
Entry
Pd630_LPD03903    CDS       T03071                                 

Definition
(GenBank) Putative primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD03903
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03903
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Pd630_LPD03903
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD03903
SSDB
Motif
Pfam: PriA_3primeBD
Other DBs
NCBI-ProteinID: AHK31116
LinkDB
Position
4095577..4097550
AA seq 657 aa
MLPLLPLAHLDREFDYLVPKDLDEQAQPGVRVRIRFAGRLVDGFVVSRNATSDHQGRFGW
LERVISPERVLTEEITRVVDLVAGRYAGTRADVLRLAIPPRHARAESEAASEPPEVPDTA
IETEAWDRYVHGGAFLTALSGERAPRAVWQALPGEDWPARLAELSGLVAATGASTVVVVP
DQRDLDRVVAAVEKLLGKDAVVGLAAGLGPALRYRRWLAALRGTAKVVVGTRSSVFAPTP
RTGLIVVWDDGDDNHSEPRAPYPHAREVALLRAYASGCAVVLAGHARTAEAQALVDSGWA
HDLVASRDSVRAAAPKITALADSDHALARDPGARAARLPAIAFAAAREALGAGRGVLVQV
PRRGYVPSLACGNCRAPARCRRCNGPLALPSAAGPDGAGTPACRWCGVADAAHRCHACGA
KALRAVVVGAGRTAEELGRAFPGVAVRMSGGTDVVDEVKEGPTLVVSTVGAEPVMPGGYG
AALLLDGWALLGRPDLRAAEETLRRWMTASSLVRPFAEGGQVVVVADSGIPTVQALVRWD
PVGHARAQYEERAEVGFPPAIHLAAIDGSAKAIADLLELADLPANAELLGPVELPAGERL
PFTGDAPEPADVERMLIRVPRGEGKPLAKVLGEAQSVRSARKDSQPARVQIDPIRIG
NT seq 1974 nt   +upstreamnt  +downstreamnt
gtgctgccgctgcttccgctagcccacctcgaccgcgaattcgactatctcgttccgaag
gacctcgacgagcaggcgcagcccggggtccgggtgcgcatccggttcgccggacgtctc
gtcgacgggttcgtcgtctcccggaacgcgaccagcgaccatcagggccgtttcggctgg
ctcgaacgggtgatctcgcccgagcgggttctgaccgaggagatcacccgggtggtcgac
ctcgtcgccggccgatacgccggaacccgcgcggacgtcctgcggctcgcgatcccgccg
agacacgcccgggcggagtccgaggccgcgtccgagccccccgaggtgccggacaccgca
atcgagaccgaggcgtgggaccggtacgtgcacggcggcgcgttcctgaccgcactgtcg
ggggagcgtgccccgcgcgcggtctggcaggcgctccccggcgaggactggccggcgcgt
ctcgcggaactgtcggggctcgtcgccgccaccggggcgagcaccgtcgtcgtcgtgccc
gatcagcgcgatctcgaccgcgtggtcgcggcggtggaaaagctgctgggtaaggacgcg
gtcgtcggactcgctgccggtctcggtccggcgctgcgctaccggcgttggctggcggcg
ctgcgcgggacggcaaaggtcgtcgtcgggacccggagttcggtgttcgcgccgacgccg
cgcaccgggctgatcgtggtctgggacgacggggacgacaaccattccgagccgcgcgca
ccgtatccgcacgcccgcgaggtggcgctgctccgcgcgtacgccagtggctgcgcggtg
gtactggccggacatgcgcgcaccgcggaggcccaggcgctggtcgactcggggtgggcg
cacgatctcgtggcctcccgggactcggtgcgggcggccgccccgaagatcaccgcactc
gctgacagtgaccacgccctggcccgcgatcccggtgcccgcgcagcccggctgcccgcg
atcgcgttcgcggctgcccgggaggcgctcggcgccggccggggagtgctggttcaggtg
ccccggcgcggctacgtgcccagcctcgcgtgcggcaattgccgggcgcccgcgcgatgc
cgacgatgcaacggacctctcgcgctgccgtcagcggccggcccggacggggcggggacg
cccgcgtgccggtggtgtggcgtcgccgacgccgcacaccgctgccacgcgtgcggagcg
aaggcgctgcgggccgtcgtggtcggtgccggacggaccgccgaggaactgggtcgcgcg
tttcccggggtcgccgtccggatgtcggggggcacggacgtcgtcgacgaggtgaaggag
ggtcccaccctcgtggtgtcgacggtcggggccgaaccggtgatgccgggcggctacggc
gcggcgttgctgctggacggctgggcgctgctgggtcgtcccgacctgcgcgccgccgag
gagacgctgcggcggtggatgacggcgtcgtcgctcgtgcgcccgttcgccgagggcggt
caggtggtcgtggtcgccgattcggggattccgaccgtgcaggcgctggttcgctgggat
ccggtcggtcacgcccgtgcgcagtacgaggagcgggcggaggtcggatttccgcccgcc
atccacctcgcggcgatcgacggcagcgcgaaggcgatcgccgacctcctggagctcgcc
gatctgccggcgaatgcggaattgctcggtccggtcgagttgccggcgggggagcggctg
ccgttcaccggcgacgcgccggagccggcggacgtggagcggatgctgatccgggtgccc
cgtggcgagggaaagccgctggccaaagtgctgggagaggcgcagtcggtgcgcagcgcg
cgtaaggactcgcagcctgcccgggtccagatcgaccccattcggatcggctag

DBGET integrated database retrieval system