KEGG   Rhodococcus opacus PD630: Pd630_LPD03920
Entry
Pd630_LPD03920    CDS       T03071                                 

Definition
(GenBank) UvrABC system protein C
  KO
K03703  excinuclease ABC subunit C
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Pd630_LPD03920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03920
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Pd630_LPD03920
SSDB
Motif
Pfam: UvrC_HhH_N UVR HHH_2 GIY-YIG HHH_5 HHH Mal_decarbox_Al CorA HHH_3
Other DBs
NCBI-ProteinID: AHK31133
LinkDB
Position
4111662..4113845
AA seq 727 aa
MPDPSTYRPATGTIPVDPGVYKFRDPHGRVIYVGKAKSLRSRLNSYFADVSTLHPRTRQM
VTTAGSVEWTVVSTEVEALQLEYNWIKEFDPRFNVRYRDDKTYPVLAVTLNEEYPRLFVY
RGPRRKGVRYFGPYSHAWAIRETLDLLLRVFPARTCSAGVFKRHNQIGRPCLLGYIDKCS
APCVGRVSAAEHRKIVEDFCDFLSGRTDKLVRQLEARMQEASEELDFETAARLRDDVGAL
RRALEKQAVVLGDGTDADVAAFATDELEAAVQVFHVRGGRVRGQRGWVVEKAGDVIDWAS
VDSEAGSDLPLLVEQFLTQFYGEQAALSGATDQEAGTSGVPREVLVPVLPPDAEQVQEWL
SGLRGSAVRLRVPQRGDKKALAETVQRNAMEALQQHKLRRAGDFTSRSAALQGIQEALDL
DSAPLRIECVDISHVQGTDVVASLVVFEDGLPRKSDYRHYAIKEAAGDGRSDDVASIAEV
TRRRFLRHNRDVGVLRAEAAGADADQVSGGDGGDLAPEAAIDPQTGRPRRFAYPPNLFVV
DGGAPQVAAASAVLDELGITDVAVIGLAKRLEEVWVPGEEDPVILPRTSESLYLLQRVRD
EAHRFAITFHRSKRSRRMTASALDSVRGLGETRRKALVTHFGSVARLKQASVEEITAVPG
IGTATAKAVLTALGAEEPSADVAGVGDDESDRNGPGTAEQNGADIPREPVAQHGPAAQSA
SQRTGVE
NT seq 2184 nt   +upstreamnt  +downstreamnt
gtgcccgatccttcgacatatcgccccgcgaccggaaccattccggtcgacccgggggtg
tacaagttccgcgatccgcacgggcgggtcatctatgtcgggaaggcgaagagtcttcga
tcacggctgaattcctatttcgccgacgtctcgacgctgcacccgcgcacccgccagatg
gtgaccacggccggcagcgtcgagtggaccgtggtgagcaccgaggtcgaggccctccag
ctcgagtacaactggatcaaggaattcgatccccggttcaacgtccgctaccgcgacgac
aagacgtacccggttctcgcggtcaccctgaacgaggaatacccccgcctgttcgtctac
cgcggtccccggcgcaagggtgtccgctacttcgggccctactcgcacgcgtgggccatc
cgcgaaaccctcgacctgctgctgcgggtgtttcctgcccgcacctgctcggccggggtg
ttcaagcgtcacaaccagatcggcaggccctgcctgctcggctacatcgacaagtgctcc
gcgccgtgcgtcggacgcgtgtccgcggccgaacaccgcaagatcgtcgaggacttctgc
gacttcctgtcaggacgcaccgacaagctggtccggcagctcgaggcccggatgcaggag
gcgtcggaagaactcgacttcgaaacggcggcgcggttgcgcgacgacgtgggcgcgttg
cggcgcgcgctcgagaagcaggccgtcgtgctcggcgacggcaccgacgccgacgtcgcc
gcgttcgcgaccgacgagctcgaggcagcggtgcaggtgttccacgtccgcggtggccgc
gtgcgcggtcagcgcggttgggtggtcgagaaggcgggtgacgtcatcgactgggccagc
gtcgattccgaggcgggatcggacctgccgctgctcgtcgagcagttcctcacccagttc
tacggtgagcaggcggcgctgtcgggcgcgaccgaccaggaggccggcaccagcggtgtg
ccgcgggaggtcctggtgcccgtgctgccgcccgacgccgagcaggtgcaggagtggctc
agcggtctccgcggatccgcggtccgcctccgcgtgccgcagcgcggcgacaagaaggct
ctcgccgagaccgtgcagcgcaacgcgatggaggcgctgcaacagcacaagctgcgccgc
gccggcgacttcacgtcccggtcggcggccctgcagggcatccaggaggccctcgacctg
gactcggcgcccctgcgcatcgaatgcgtcgacatcagccacgtgcagggcaccgacgtg
gtggcctccctcgtcgtcttcgaggacggcctgccccgcaagtccgactaccggcactac
gcgatcaaggaggccgcgggcgacggtcgctccgacgacgtcgccagcatcgccgaggtc
acccggcggcggttcctccggcacaaccgcgacgtcggggtgctgcgcgccgaagcggcc
ggggcggacgccgaccaggtgtcgggcggggacggcggcgatctggcgccggaggcggcg
atcgatccgcagaccggcaggccgcggcggttcgcgtacccaccgaacctgttcgtcgtg
gacggcggagccccgcaggtggccgcggcctcggcggtgctcgacgaactgggcatcacc
gacgtcgccgtgatcgggctggccaagcggctcgaggaggtgtgggtgccgggggaggag
gacccggtcatcctcccgcgcacgagcgagtcgctgtacctgctgcagcgggtgcgcgac
gaggcgcaccgtttcgcgatcacgttccaccgcagcaagcggtcccgccggatgacggcg
tccgccctcgactcggtccgcgggctcggcgagacccggcgcaaggccctggtgacgcat
ttcggatccgtcgcccgcctcaagcaagcctccgtcgaggagatcaccgcggtccccggc
atcggaacggccacggcgaaagcggtactcaccgctctcggggcggaggaaccgtctgcg
gacgtcgcgggagtgggggatgatgaatcagatcggaacgggccgggcacggcagaacag
aacggcgcggacattccccgcgaaccggtagcacagcacggcccggcagcacagagcgca
tcgcaacggacaggtgtcgagtga

DBGET integrated database retrieval system