KEGG   Rhodococcus opacus PD630: Pd630_LPD03951
Entry
Pd630_LPD03951    CDS       T03071                                 

Definition
(GenBank) putative DNA repair protein
  KO
K10979  DNA end-binding protein Ku
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Pd630_LPD03951
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03951
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Pd630_LPD03951
SSDB
Motif
Pfam: Ku TF_Zn_Ribbon
Other DBs
NCBI-ProteinID: AHK31164
LinkDB
Position
complement(4145372..4146268)
AA seq 298 aa
MERMRSIWKGSIAFGLVNVPVKVYSATEDHDIRFHQVHAKDGGRIKYNRVCSECGNVVQY
ADIDKAYDSDDGVRVVLTDDDFGKLPAAEKHEIPVLQFVPTEQIDPILFEKSYFLEPDSS
SPKAYVLLATALENSDRTALVHFTLRQRTRLAAMRSRDGVLVIQTLLWPDEVRAAEFSSL
DGVDKPKAKELAMAETLVDSMADDFDPTEFTDDYQVQLRELLDEMIESGGKKVIPVAEVE
KSGEDAEVVDLVAALQRSVDAAGKKAAPAKKKPAKKAPAKTAAKKATAKSSSSERKRA
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaacgcatgcggtcgatatggaagggctcgatagcgttcggactcgtgaatgtgccg
gtcaaggtctattcggcaaccgaggatcacgacatcaggtttcaccaggtccatgccaag
gacggcggccggatcaaatacaaccgcgtctgctccgaatgcggcaacgtcgtccaatac
gccgatatcgacaaggcctacgactccgacgacggcgtgcgcgtggtgttgacggacgat
gatttcggcaaactgcccgccgccgagaaacacgagattcccgttctgcagttcgtgccg
accgaacagatcgaccccattctgttcgagaagagttacttcctcgaaccggattccagc
tctccgaaggcatatgtcctactcgcgacagccctcgagaacagcgaccgaacggccctc
gtccacttcaccctccgacagcgcacccgactggccgcgatgcgttcacgggacggggtg
ctggtgatccagacgctgctgtggccggatgaggtacgggccgcggaattctcctcactc
gatggcgtcgacaagccgaaggcgaaggaactcgcgatggccgagacactcgtcgacagc
atggccgacgacttcgaccccaccgaattcaccgacgactaccaggtgcagttgcgtgaa
ctgctcgacgagatgatcgagtccggcggcaagaaggtcatccccgtcgccgaggtcgag
aagagcggcgaggacgccgaagtggtggatctcgtggccgcactgcagcgcagcgtcgac
gccgccgggaagaaggccgcacccgccaagaagaagccggcgaagaaggctccggccaag
accgcagcgaagaaggccacagcgaagtcatccagttcggaacgcaagcgcgcctga

DBGET integrated database retrieval system