KEGG   Rhodococcus opacus PD630: Pd630_LPD04415
Entry
Pd630_LPD04415    CDS       T03071                                 

Definition
(GenBank) excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Pd630_LPD04415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD04415
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Pd630_LPD04415
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Pd630_LPD04415
SSDB
Motif
Pfam: UvrA_DNA-bind ABC_tran AAA_16 AAA_29 AAA_25 AAA_33 DnaJ_CXXCXGXG AAA_21 RsgA_GTPase Anti-TRAP APS_kinase AAA_22 NACHT MeaB Viral_helicase1 DUF4350 NTPase_1 cobW
Other DBs
NCBI-ProteinID: AHK31628
UniProt: W8HEX2
LinkDB
Position
complement(4624091..4626628)
AA seq 845 aa
MPTFDPAPQAEPLRAQDFNGIAVFDASEHNLAHVDVFIPRDCIVAFTGVSGSGKSSLAFG
TIYAEAQRRFLESVTPYARRLMDQIGAPRVGDITGLPPAVALQQARGHTSARSSVGTLTH
ISNVLRMLFSRVGTYPPGAPVLDSNAFSPNTPEGGCPACHGLGRTHDVDIDALVPDPSRS
IRGGAVAAWPGAWLGKNYRDILATLGIDVDRPWSELPEDQREWILTTDEQPTVTVSPVRD
PGKMVRDYQGTFSSARTYVLHTYATTKSATQRAKVARYLVSRPCSACNGKRLRPEALAVR
FAGLDIADATELSLAALASVLDAVVASRDSAASDATERASASLVDNLRGRLAGLTELGLG
YLSLGRSTTTLSPGELQRLRLATQLQSGLFGVLYVLDEPSAGLHPADTEALVTAVRRLRA
AGNSVFVIEHNLDVVRAADWIVDVGPGPGEHGGRVLYSGEVDGLAHVPESVTRRYLFGTP
ESYPDPGPPDRWIELAGITMHNLRDLTVRIPLGVLTAVTGVSGSGKSTLVSRVLTDVVAQ
HVGLDSEPRTDTGGDEADDSTVVLAEEREKDTEPTVVAAHGLGHINRLVRVDQTPIGRTP
RSNLATYTGLFDVIRKLFAAHPVARERGYSPGRFSFNVSGGRCEECEGAGSITIGMLFLP
EASAPCPACAGARYNAETLEVLVDGRTIADVLAMTVDDARAFLSHVPAAAKSLDMLVEVG
LGYLRLGQSATTLSGGEAQRVKLASELQRIRSGHTLYVLDEPTTGLNPADVDRLMVVLRR
LVAAGNTVVLVEHDMPVIASADWMIDLGPGGGDSGGRIIASGPPTVVAETAGSATAAYLA
RHLAR
NT seq 2538 nt   +upstreamnt  +downstreamnt
gtgcccaccttcgatcctgcaccgcaggccgaaccgctacgtgcccaggacttcaacggc
atcgcagtgttcgacgccagtgaacacaacctcgcccacgtcgatgtgttcattccccgg
gactgcatcgtcgcctttaccggggtctcgggatcggggaagtcgtcgttggccttcggc
accatctatgccgaagcgcaacgacgattcctcgagtccgtgaccccgtacgcacgccgg
ctgatggatcagatcggagcgcccagggttggggacatcaccgggcttccaccggcggtc
gccttgcagcaggcccgcggtcacacgtccgcccgatcgtcggtcggcaccctcacccac
atctcgaacgtgctgcggatgctgttctcccgagtcggtacctacccgccgggtgccccc
gttctcgactcgaacgcgttctcgcccaacacacccgaaggcggatgcccagcctgccac
gggctcggccgtacccacgacgtcgacatcgatgccctggtgccggacccgagccgaagt
atccgcggcggcgccgtcgccgcatggccaggtgcctggctgggaaagaactaccgcgac
atcctcgcaaccctcggaatcgacgtggaccgcccctggtccgagctcccggaagaccag
cgtgagtggatcctcaccaccgacgagcaacccaccgtcacggtgtcacccgtgcgcgac
ccgggcaaaatggtgcgcgactaccagggaacgttctcgagtgcccgcacctacgttctg
cacacctacgcgacgacgaagagcgcaacccagcgggcgaaggtcgcccgatatctggtg
tcccgaccctgcagtgcatgcaacggcaaacggctgcgccccgaggcgctggctgtccgg
ttcgccggcctcgacatagccgacgccacggaactgtcactggccgctctggcctcggtc
ctcgacgccgtcgtcgcatcccgcgattccgccgcaagcgacgcgacagaacgagcatcg
gcgtccctggtagacaaccttcgcggacgcctcgcgggtctgaccgaactcgggctggga
tacctgagtctcggccgatcgaccaccaccctctcgccgggagaacttcagcgactgcgg
ctggccacccagctgcaatcgggtctgttcggagtgctgtacgtcctcgacgaaccgtcc
gcaggccttcatcccgccgacaccgaggcactggtcaccgccgtgcggcggctgcgcgcg
gcaggtaactccgtcttcgtcatcgaacacaacctcgacgtcgtccgggcggcagattgg
atcgtcgacgtcggtcccggtcccggtgagcatggtgggcgggtgctctacagcggtgag
gtggacggtctcgctcacgtccccgaatccgtgactcgccgataccttttcggaaccccc
gagagttaccccgaccccggaccgccggacaggtggatcgaactcgccggcatcacgatg
cacaacctgcgggatctgaccgtgcgaatcccgctcggggtgctcaccgcggtcacgggt
gtgtcgggatcaggtaaatccacactcgtgagccgtgtgctcaccgacgtcgtcgcccag
cacgtcggcctcgacagcgaaccccgcaccgacaccgggggagacgaagccgacgactcc
acggtcgtcctggccgaggagcgcgagaaggataccgagccgacggtagtggccgcccac
gggctgggacacatcaaccggctggtgcgcgtggaccagaccccgatcgggcggacgccg
cgctcgaatctcgcgacctacaccggtctcttcgatgtgatccggaaactcttcgccgca
caccccgttgcccgtgaacggggatacagtccgggccgattctcattcaatgtcagtggt
ggccgttgcgaggaatgcgagggcgccggttcgatcaccatcggtatgctgtttctgccc
gaggcgtccgcgccgtgcccggcgtgcgcaggcgcacgatacaacgcggagaccctcgag
gtcctcgtcgacggccggacgatcgccgacgtcctcgcgatgacggtcgacgacgcccgc
gctttcctgagtcacgtcccggcagcggcgaaaagccttgacatgctggtcgaagtcggt
ctcggatatctgcgactcggccaatcggccaccaccctgtccggcggggaggcgcagcgc
gtcaagctcgccagcgaactgcagcgcatccgatccgggcacacgctctacgtactcgac
gaaccgaccaccggattgaaccccgccgacgtcgatcgcctcatggtggtgttgcgacgg
ctcgtcgcggcgggaaataccgtcgtcctcgtcgaacacgacatgccggtcattgcctcg
gcggactggatgatcgatctcgggcccggcgggggagacagcggcggccggatcatcgcc
tcggggccaccgacggtcgttgcggagacggccggctccgccaccgccgcctatctcgcc
cgacatctcgcccggtga

DBGET integrated database retrieval system