KEGG   Rhodococcus opacus PD630: Pd630_LPD05015
Entry
Pd630_LPD05015    CDS       T03071                                 

Definition
(GenBank) ADP-ribose pyrophosphatase
  KO
K01554  8-oxo-dGDP phosphatase [EC:3.6.1.58]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05015
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.58  8-oxo-dGDP phosphatase
     Pd630_LPD05015
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Pd630_LPD05015
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-ProteinID: AHK32226
UniProt: W8H344
LinkDB
Position
complement(5196520..5197188)
AA seq 222 aa
MTDTGRHEFETLDSRAVYSGAILALRVDHVAMPDGRTAEREVVEHHGAVAVVVLDDEDRV
VLIHQYRHPVGRRLWEIPAGLLDEPGEDPVDAAGRELAEETGLGARRWSVLVDVVLSPGF
TDESVRVFLAEDLYDVDRPDPEDEEADLEIERIPLDEVVSMVLNGTIVNATAVAGVMALA
AARSRPGGLGELRDVTAPWVDRPDRFSERKRSRAAGDEAARA
NT seq 669 nt   +upstreamnt  +downstreamnt
atgacggacaccggccggcacgaattcgagactctcgactcgcgcgccgtctacagcggc
gcgatcctcgccctgcgggtggatcacgtcgcgatgccggacggccggaccgccgaacgt
gaggtggtcgagcaccacggcgccgtcgccgtcgtggtgctcgacgacgaggaccgggtc
gtcctgatccaccagtaccggcacccggtggggcgccggttgtgggagataccagcgggc
ctgctggacgagccgggggaggaccccgtcgacgccgccgggcgcgagctggcggaggag
accggactcggagcccgtcgctggtccgttctcgtggacgtcgttctctcgcccgggttc
acggacgagtcggtgcgcgtgttcctcgccgaggacctgtacgacgtggaccggcccgat
ccggaggacgaggaagccgacctcgagatcgagcggattccactcgacgaggtcgtgtcg
atggtgctgaacgggacaatcgtgaacgccacggccgtagccggtgtgatggccctcgcc
gctgcccggtcccggccgggcggtctcggcgaactccgcgacgtgaccgcgccctgggtc
gatcgccccgacaggttcagcgagagaaaacgctcgcgcgccgccggggacgaggccgcg
cgggcatga

DBGET integrated database retrieval system