KEGG   Rhodococcus opacus PD630: Pd630_LPD05019
Entry
Pd630_LPD05019    CDS       T03071                                 

Definition
(GenBank) DNA repair protein recN
  KO
K03631  DNA repair protein RecN (Recombination protein N)
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05019
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pd630_LPD05019
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pd630_LPD05019
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_22 AAA_21 AAA_15 ABC_tran AAA_29 Sigma54_activat DUF2458
Other DBs
NCBI-ProteinID: AHK32230
UniProt: W8H7H1
LinkDB
Position
complement(5201362..5203134)
AA seq 590 aa
MLAEIRIDNLGVISEASAQFHEGLTVLTGETGAGKTMVVTSLHLLSGARADAGRVRLGAP
RAVVEGRFMTDDGSEHVERAVSRLLESTGAERDEDGTIIAVRTVGSDGRSRAHLGGRSVP
AGVLSEFTDPLLTVHGQNDQLRLLRPDQQCAALDRFADKTVGPLLARYRKHRDEWVTARS
ELIERTGRTRELAQEADQLTFALNEIDGIAPTPGEDESIVSEVRRLSELDSLRSAAEEAH
AALAGGDDMDGDGVGAPALDLLSEARARIESATDPELDGLGPRLADAIAVVTDVSADLTT
YLAGLPADPGALDSLLSRQAELKNLTRKYAADVDGVLEWADNARARLEKIDVSSDALAAL
TKQVEESATSTAEAASKLTAARVKAAAKLAKAVSSELAGLAMGRAALEVSVRPRIAGPQD
TAPLTVDGTELHAGSSGVDEVEFRLSAHSGAQSLPISKSASGGELSRVMLALEVVLAGSD
SGATMVFDEVDAGVGGRAAVEIGRRLARLARTHQVIVVTHLPQVAAFADTHLVVDKVDDT
DGVVSSGVHTLTDDERVVELARMLAGLDDTETGRAHAEELLATANAERSV
NT seq 1773 nt   +upstreamnt  +downstreamnt
gtgctggcagagatcaggatcgacaacctcggtgtgatctccgaggcgtcggcgcaattc
cacgaaggtttgaccgtgctcaccggtgagaccggtgcgggcaagacgatggtggtgacg
agcctgcacctgctcagcggtgcgcgagcggacgcgggccgggtgcgtctcggcgcgccc
cgtgccgtggtcgagggccggttcatgacggacgacggctcggagcacgtcgaacgtgcc
gtgtcccggctgctcgaatcgaccggcgccgagcgggacgaggacggcaccatcatcgcg
gtgcggaccgtcggcagcgacggacggtcccgcgcccacctgggtgggcgcagcgttccg
gcgggcgtgctgtccgagttcaccgatccactgctcaccgttcacgggcagaacgatcag
ctgcggctcctccggcccgaccagcagtgcgccgccctggacaggttcgcggacaagacg
gtcggcccgctgctggcgcggtaccgcaagcaccgcgacgaatgggtgaccgcacggtcc
gaactgatcgaacgcaccgggcgtacccgggaactcgcgcaggaagccgaccaactgacg
ttcgccctcaacgagatcgacggcatcgcgcccaccccgggcgaggacgagtcgatcgtg
tcggaggtgcgcaggctcagtgaactcgactcgctgcgctcggcggccgaggaagcgcac
gccgcgctcgccggcggcgacgacatggacggcgacggtgtgggcgcacccgcgctggat
ctgttgtccgaggcgcgggcccggatcgaatcggccaccgaccccgaactcgacgggctc
ggaccgcgtctcgccgacgcgatcgcggtggtcaccgacgtctccgccgacctgaccacg
tatctcgccgggcttcccgcggatccgggggcgctggactccttgctgtcgaggcaggcg
gaactgaagaacctcacccgcaagtacgccgccgacgtcgacggcgtattggaatgggca
gacaacgcccgtgcgaggctcgagaagatcgacgtgtcctccgatgccttggcggcgttg
acgaagcaggtcgaggagtcggcgacgtccaccgcggaggccgcgtcgaaactgaccgcg
gcccgcgtcaaggcggcggccaagctcgccaaggccgtcagttccgaactcgcaggtctg
gcgatgggccgggccgctctcgaggtgtcggtccggccccggatcgccggaccgcaggac
accgccccgctcaccgtcgacgggacggaactgcacgcgggatcgtccggcgtcgacgaa
gtggaattccggctgtcggcgcacagcggcgctcagtcgctgcccatcagcaagagtgcg
tcgggtggtgaactctcgcgcgtgatgctggccctcgaggtggtgctcgccgggtccgat
tcgggcgcgacgatggtgttcgacgaggtcgacgccggcgtcggcggtcgggccgcggtc
gagatcggccggcgactggcccggctcgcccggacacaccaggtcatcgtcgtgacgcac
ctgccgcaggtcgcggcgttcgcggacacccacctggtggtcgacaaggtcgacgacacg
gacggggtcgtcagcagtggtgtgcacacactcaccgacgacgaacgggtggtggaactg
gcgcgcatgctcgccggactcgacgacacggagaccggtcgggcccacgcggaggaactg
ttggccaccgccaacgccgagcgttccgtctga

DBGET integrated database retrieval system