KEGG   Rhodococcus opacus PD630: Pd630_LPD05029
Entry
Pd630_LPD05029    CDS       T03071                                 

Definition
(GenBank) Putative 3-methyladenine DNA glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Pd630_LPD05029
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05029
Enzymes [BR:roa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     Pd630_LPD05029
DNA repair and recombination proteins [BR:roa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Pd630_LPD05029
 Prokaryotic type
     Pd630_LPD05029
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-ProteinID: AHK32237
LinkDB
Position
complement(5214364..5214981)
AA seq 205 aa
MTIDRLDRAEPVDAARIVLGSMLIVGDVRIRIVEVEAYGGEKDGPWPDPASHSYRGKTPR
NEVMFGPAGHLYVYRSYGMHFCMNVSYGPVGSAGGVLLRAGEVLDGCATVQARRPRVTRP
ADWARGPGNLGSATGVTLAENGAALFEHDSPVRLEVAESDGWVSGPRVGVSTAADRPWRF
WIPESPAVSAYRRSPRAMPADEQMG
NT seq 618 nt   +upstreamnt  +downstreamnt
gtgaccatcgatcgacttgaccgggcggaacccgtcgatgccgcgcgaatcgttctcgga
tccatgctgatcgtcggagacgtccgcatccgcatcgtcgaagtggaggcgtacggcggg
gagaaggacggcccgtggcccgatccggcatcgcactcctaccgagggaagacgccgcgc
aacgaggtgatgttcggcccggccgggcacctgtacgtctaccgcagttacgggatgcac
ttctgcatgaacgtgtcgtacgggccggtcggaagcgcgggcggggtgcttctccgggca
ggcgaagtgctcgacggttgcgcgacggttcaggcgcgccggccccgcgtcacgcgacct
gcggattgggcgcgcggtcccggcaacctggggtccgcgaccggcgtaaccctcgccgag
aacggtgcggcgttgttcgagcacgattcgccggttcgactggaggtcgcggagtcggac
ggctgggtgagtggcccccgtgtcggtgtcagcacggccgccgaccggccgtggcgcttc
tggattccggagtcgccggcggtatccgcgtaccggagaagcccgcgtgcgatgcccgcc
gacgagcagatgggatga

DBGET integrated database retrieval system