KEGG   Rhodococcus opacus PD630: Pd630_LPD05054
Entry
Pd630_LPD05054    CDS       T03071                                 

Definition
(GenBank) UvrABC system protein A
  KO
K03701  excinuclease ABC subunit A
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Pd630_LPD05054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05054
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Pd630_LPD05054
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Pd630_LPD05054
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran AAA_16 AAA_29 SMC_N AAA_21 RsgA_GTPase AAA_25 APS_kinase NACHT DnaJ_CXXCXGXG ScfRs DNA_ligase_ZBD Viral_helicase1 cobW NTPase_1
Other DBs
NCBI-ProteinID: AHK32262
UniProt: W8H2I3
LinkDB
Position
complement(5238333..5241311)
AA seq 992 aa
MRGAREHNLRGVDLDLPRDSLIVFTGLSGSGKSSLAFDTIFAEGQRRYVESLSAYARQFL
GQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVGTITEVYDYLRLLYARAGTAHCPVCGE
QIARQTPQQIVDQVLDMEEGTRFQVLAPVVRTRKGEFVDLFDQLNMQGYSRVRVDGVVHP
LSDPPKLKKQEKHDIEVVVDRLTVKASSKQRLTDSVETALRLAEGIVVLDFVDREENAAD
RERRFSEKLACPNGHALSIDDLEPRSFSFNSPYGACPECTGLGIRKEVDPDLVVPDPELS
LEDGAIAPWSMGQSSEYFGRLLSGLGDILGFDMKTPWNKLPAKARRAILEGSEEQVHVRY
KNRYGRTRSYYAEFEGVMPFLHRRLEQTESDQMKERYDGYMRDTPCPACGGARLRPEILS
VTIANEKFGMKSIAEVCELSISDCADFLNSLTLGSREEAIAGQVLKEVQARLGFLLDVGL
EYLSLARAAGTLSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNRRLIETLTRLR
DLGNTLIVVEHDEDTIRTSDWVVDIGPLAGEHGGKVVHSGPYEDLLDCEESLTGAYLSGR
SHIEIPAIRRPVDRKRQVTVIGAREHNLGGIDVSFPLGVLTSVTGVSGSGKSTLVNDILA
TVMANKLNGARQVPGRHTRINGLDQLDKLVQVDQSPIGRTPRSNAATYTGVFDKIRTLFA
ATTESKVRGYQPGRFSFNVKGGRCEACSGDGTLKIEMNFLPDVYVPCEVCHGARYNRETL
EVHYKGKTIAEVLDMPIEEAAEFFEPITSIHRYLKTLVEVGLGYVRLGQPAPTLSGGEAQ
RVKLAAELQKRSTGRTVYILDEPTTGLHFEDIRKLLGVVNGLVDKGNTVIVIEHNLDVIK
TSDWVVDMGPEGGSGGGTVVAQGTPEEVAQVPESYTGRFLENVLEVPAPPAAAKSKAAKS
TSTRKPASTKKTAAAATATPRKRAPKKAAAVS
NT seq 2979 nt   +upstreamnt  +downstreamnt
gtgcggggtgcccgtgagcacaatctgcgaggggtcgatctcgatctgccccgcgacagc
ctgatcgtgttcaccgggctgtcgggctcgggcaagtcgagtctggcgttcgacacgatc
ttcgccgagggccagcgacgctatgtcgagtcgctgtcggcgtacgcgcgccagttcctc
ggtcagatggacaagcccgacgtcgacttcatcgaaggtctgtcgccggcggtgtccatc
gaccagaagtcgaccaaccgcaacccgcggtcgacggtcggcaccatcacggaggtctac
gactatctccgtctgctgtacgcccgggcgggcaccgcccactgcccggtgtgtggcgag
cagatcgcgcggcagacgccgcagcagatcgtcgaccaggtcctcgacatggaggaaggc
acccgcttccaggtgctcgctcccgtcgtgcgtacccgcaagggcgaattcgtcgacctg
ttcgaccagctcaacatgcagggctactcacgtgtgcgggtcgacggcgtcgtgcatccg
ctctccgatccgccgaagctcaagaagcaggagaagcacgacatcgaggtcgtcgtcgac
cgcctcaccgtcaaggccagctccaagcagcggctcaccgactccgtcgagaccgcgctg
cggttggcggagggcatcgtcgtcctcgacttcgtcgaccgcgaagagaacgccgcggac
cgggaacgccgattctcggagaagctggcatgcccgaacggccacgctctctccatcgac
gacctcgaaccccggtcgttctcgttcaactccccctacggcgcctgccccgagtgcacg
ggcctcggaatccgcaaggaggtcgaccccgacctcgtggtccccgaccccgagctgtcc
ctcgaggacggcgccatcgcgccgtggtcgatggggcagagttccgaatacttcggccgc
ctgctgtccgggctcggcgacattctcggcttcgacatgaagacgccgtggaacaagctg
cccgcgaaggcacgccgggcgatcctcgagggcagcgaggagcaggtccacgtccggtac
aagaaccggtacgggcgtacccgttcctactacgccgagttcgagggcgtcatgcccttc
ctgcaccgccgcctcgagcagaccgagtcggaccagatgaaggaacgctacgacggctac
atgcgagacaccccgtgtccagcgtgtggcggtgcgcgcctgcgccccgagatcctgtcg
gtcacgatcgcgaacgagaagttcggcatgaagtcgatcgccgaggtctgtgaactgtcg
atctccgattgcgccgacttcctgaacagcctcacgctgggcagtcgcgaggaggccatc
gcaggtcaggtgctcaaggaagttcaggctcgtctcggcttccttctcgacgtcggcctc
gaatacctgtcgctcgctcgcgccgccgggacgctgtccggcggtgaggcgcagcgtatc
cgcctcgccacccagatcggctcgggcctggtgggcgtcctgtacgtcctcgacgagccg
tcgatcggtctgcatcagcgcgacaaccggcgtctcatcgagaccctgacgcgcctgcgc
gacctcgggaacacgctcatcgtggtcgaacacgacgaagacaccatccgcacgtccgac
tgggtcgtcgacatcgggccgctcgccggcgaacacggaggcaaggtcgtccacagcggg
ccgtacgaggacctgctcgactgcgaggaatccctcaccggggcctacctgtcgggccgc
agtcacatcgagattccggccatccgccgaccggtcgatcgcaagcggcaggtcacggtc
atcggtgcgcgcgaacacaacctcgggggcatcgatgtcagcttcccactgggcgtgctc
acgtcggtcaccggtgtgtccgggtccggtaagtcgacgctcgtcaacgacatcctcgcg
acggtgatggcgaacaagctcaacggcgcccgccaggtgccgggcaggcacacccgcatc
aacgggctcgaccagctggacaagctcgtgcaggtcgaccagtcgccgatcggccgcacc
ccgcggtccaacgcggccacctataccggggtgttcgacaagatccgcaccctgttcgcc
gccaccaccgagtcgaaggtgcgcggctaccagccgggccggttctcgttcaacgtcaag
ggcggccggtgcgaggcctgctccggcgacggcacgttgaagatcgagatgaacttcctt
cccgacgtgtacgtgccgtgcgaggtctgccacggcgcccggtacaaccgcgagactctc
gaggtccactacaagggcaagaccatcgccgaggtgctggacatgccgatcgaggaggcc
gcggagttcttcgagcccatcacctcgatccaccgctacctcaagaccctggtcgaggtc
ggtctcgggtacgtgcggctcggtcagcccgcaccgacgctgtccggtggtgaggcgcag
cgcgtgaagctcgccgccgagctgcagaaacggtcgacgggccgcacggtgtacatcctc
gacgagcccacgacgggtctgcacttcgaggacatccgcaagttgctcggggtcgtcaac
gggttggtcgacaagggcaacacggtgatcgtgatcgagcacaacctcgacgtgatcaag
acctccgactgggtggtcgacatggggcccgagggcgggtccggcggcggcaccgtcgtc
gcgcagggcaccccggaggaggtggcgcaggttccggagagttacacgggtcggttcctg
gaaaacgtcctcgaggtgccggcgcctcccgctgcggcgaagtcgaaggcggccaagtcg
acgtcgacgcggaagcccgcttcgacgaagaagactgccgcggccgccacggcgacaccg
cgcaagcgggcgccgaagaaggccgcagcagtcagctga

DBGET integrated database retrieval system