KEGG   Rhodococcus opacus PD630: Pd630_LPD05078
Entry
Pd630_LPD05078    CDS       T03071                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03410  Base excision repair
roa03420  Nucleotide excision repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05078
   03410 Base excision repair
    Pd630_LPD05078
   03420 Nucleotide excision repair
    Pd630_LPD05078
   03440 Homologous recombination
    Pd630_LPD05078
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05078
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05078
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD05078
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     Pd630_LPD05078
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     Pd630_LPD05078
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Pd630_LPD05078
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc HHH_5 DNA_pol_lambd_f
Other DBs
NCBI-ProteinID: AHK32287
LinkDB
Position
complement(5262856..5265519)
AA seq 887 aa
MLLDGHSLAFRAFYALPAENFKTHSGQVTNAVYGFTSMLINLLRDEQPSHVAAAFDVSRQ
TFRAEKFPEYKANRSKAPDEFKGQVEITKDVLGALGIPVMAEEGFEADDIIATLTTQAEA
LGYRVLVVTGDRDSLQLVTDGVTVLYPKKGVSDLTRFTPAAVEEKYGLTPAQYPDFAALR
GDPSDNLPGIPGVGEKTATKWIKEYGDLVGLVDNVDKVRGKVGDALRENLPNVLLNRELT
EMVRDVPLPYTPDQLMLAQWDREKIHALFDDLEFKVLRDRLFATLAPVEAEAEEGFEVRG
SALDPGAVADWLSAHASTGERSGVSVVGTRTPYGGDVTAIAIAAADGEGAYVATASATPE
DEKALGNWLADADQPKALHEAKWAMHALRGRGWVLGGLTSDTALAAYLVRPGQRTFNLDD
LSLRYLRRELRVEETGQEQLSLLDDADQVDAEAAETEILSARAVLDLAAALDTELANIES
TALLSEMELPLLEVLADIEASGIAVDGDHLHDLQSRFAAEVSAAAEAAYGVIGKQINLGS
PKQLQVVLFDELEMPKTKKTKTGYTTDAEALQNLFEKTSHPFLEHLLAHRDATRLKVTVD
GLLKTVAEDGRIHTTFNQTVAATGRLSSTEPNLQNIPVRTDAGRQIRDGFVVGEGYDSLL
TADYSQIEMRIMAHVSGDEGLIEAFNTGEDLHSFVGARAFGVPIEEVTPELRRRVKAMSY
GLAYGLSAFGLAAQLKISTEEAKSQMEAYFARFGGVRDYLHEVVERARKDGYTSTLYGRR
RYLPDLTSDNRQRREVAERAALNAPIQGTAADIIKVAMINVQRSLREAGLKSRMLLQVHD
ELVLEVVDSEREQVEQLVRDKMSSAIELSVPLDVSVGTGRSWDAAAH
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgctgctcgacggccactcgctggccttccgcgcgttctacgccctgcccgccgagaac
ttcaagacgcacagcggtcaggtcaccaacgccgtctacgggttcacgtcgatgttgatc
aacctgctgcgcgacgaacagccgagccacgtggcggcggcgttcgacgtgtccaggcag
acgttccgggcggagaagttccccgagtacaaggcgaatcgcagcaaggctccggacgag
ttcaaggggcaggtcgagatcaccaaggacgtactcggggccctcggcatcccggtgatg
gccgaggaaggcttcgaggccgacgacatcatcgccacgctcaccacccaggccgaggcg
ctcgggtaccgcgtcctcgtggtgaccggcgaccgggactcgctccagctggtcaccgac
ggggtcacggtgctctacccgaagaagggcgtctcggacctcacccggttcacgcccgcg
gccgtcgaggagaagtacgggctcacacctgcgcagtaccccgacttcgcggcactgcgc
ggcgacccgagcgacaacctgccgggcatcccgggtgtcggggagaagaccgccaccaag
tggatcaaggagtacggcgatctcgtcggcctggtcgacaacgtcgacaaggttcgcggc
aaggtcggtgacgcactgcgggagaacctgccgaacgtcctgctcaaccgcgaactgacc
gaaatggtgcgcgacgtcccgctgccgtacaccccggaccagctgatgctcgcgcagtgg
gatcgggagaagattcacgcgctgttcgacgacctcgagttcaaggtgctgcgcgaccgg
ctgttcgccacgttggccccggtcgaagcggaggccgaggaggggttcgaggtgcgcggg
agcgcgctcgatcccggggccgtcgcggactggctgtcggcgcacgcgtcgacgggcgag
cgatccggcgtgtcggtggtcggcacccgcaccccgtacggcggtgacgtgacggcgatc
gccatcgccgccgccgacggcgagggcgcctacgtcgccaccgcttccgccaccccggag
gacgagaaggcgctcggcaactggctcgccgacgcggatcagccgaaggccctgcacgag
gcaaagtgggcgatgcacgcgctgcgcggacgcggctgggtgctcggtggtctcaccagc
gacaccgcgctggcggcctacctggtgcggcccgggcagcggacgttcaacctcgacgac
ctgtcgctgcggtacctgcgcagggagctgcgggtggaggagaccggccaggagcagctg
tcgctgctcgacgacgccgaccaggtcgacgcggaagccgccgagaccgaaattctcagc
gcccgcgccgtcctcgacctcgcggccgcgctcgacaccgaactcgcgaacatcgaatcg
acggcgctgctgtccgagatggagttgccgctgctcgaggtgctggccgacatcgaggcg
tccggtatcgccgtcgacggtgaccacctgcacgacctgcagagccggttcgcggccgag
gtctccgcggcggcggaggcggcctacggggtcatcggcaagcagatcaacctcgggtcg
cccaaacagctgcaggtcgtgctgttcgacgagctggagatgcccaagacgaagaagacg
aagaccggttacaccacggacgccgaggcgttgcagaacctgttcgagaagacgtcgcac
ccgttcctcgagcacctgctcgcgcaccgcgacgcgacgcggctgaaggtgaccgtcgac
gggctgctgaagacggtcgccgaggacggccgtatccacacgacgttcaaccagaccgtc
gcggccaccggccggctgtcgtcgacagagcccaacctccagaacatcccggtccgcacc
gacgccggcaggcagatccgggacggtttcgtcgtcggcgagggctacgactcgctgctc
acggccgactacagccagatcgagatgcggatcatggcccacgtgtccggtgacgagggg
ctgatcgaggcgttcaacaccggcgaagacctgcacagcttcgtcggcgcgcgtgcgttc
ggcgtgccgatcgaggaggtcaccccggagctgcgccgccgcgtgaaggcgatgtcctac
gggctggcgtacgggctgagcgcgttcggtctggccgcccagctcaagatctcgaccgaa
gaggccaaatcgcagatggaggcgtacttcgcgcggttcggcggggtacgcgactacctg
cacgaggtcgtggaacgggcccgcaaggacggctacacgtcgacgctgtacgggcgtcgc
cgctacctgcccgacctcaccagcgacaaccgccagcgtcgggaggtcgccgagcgggcc
gcgctcaacgcccccatccagggcacggccgccgacatcatcaaggtcgcgatgatcaac
gtgcagcggtcgctgcgcgaggcgggcctgaagtcgcggatgctgctgcaggtccacgac
gaactcgtgctcgaggtcgtcgattcggaacgggaacaggtcgaacagctggtccgcgac
aagatgtcctcggccatcgagctgtcggtgccgctcgacgtgtccgtcggcaccggtcgc
agttgggacgccgccgcacactag

DBGET integrated database retrieval system