KEGG   Rhodococcus opacus PD630: Pd630_LPD05326
Entry
Pd630_LPD05326    CDS       T03071                                 

Definition
(GenBank) DNA repair protein recO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD05326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05326
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pd630_LPD05326
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pd630_LPD05326
SSDB
Motif
Pfam: RecO_C RecO_N DUF3724 RecO_N_2
Other DBs
NCBI-ProteinID: AHK32529
UniProt: W8HC47
LinkDB
Position
complement(5504754..5505545)
AA seq 263 aa
MVLRQHKLGEADRIVTLLTRQHGLVRAVAKGVRRTKSKFGARLEPFAHIDVQLYPGRNLD
IVTQVQTVDAFATDIVDDYSRYTTACAILETAERLAGEERAPAPQLHRLTVGALRAVAEH
NRSCELILDAFLLRAMGFAGWAPALDDCARCSAPGPHRAFHVAAGGAVCVHCRPPGAATP
SPGVLDLMDALIRGDWASTDDVPESLRGQASGLVAAHLQWHLERQLRTLPLIERARPHAA
VGVEDSVRQDGDRDSTTRTSSPA
NT seq 792 nt   +upstreamnt  +downstreamnt
gtggtgctgcgccagcacaagctgggcgaggccgaccgtatcgtcacactcctcacccgg
cagcacggtctggtgcgcgcggtcgccaagggggtgcgccgcacgaagtccaagttcggc
gcccggctcgagccgttcgcgcacatcgacgtgcagctctaccccggccgcaacctcgac
atcgtcacccaggtccagacggtcgacgcattcgcgaccgacatcgtcgacgactattcc
cggtacaccacggcgtgcgcgatcctcgagaccgccgagcggctcgccggtgaggagcgg
gctccggcgccgcaactgcatcgactgacggtcggggcgctgcgggccgtcgccgagcac
aaccgctcgtgcgagctgatcctcgacgccttcctgttgcgggccatgggttttgcgggg
tgggctcccgccctcgacgactgcgcgcggtgcagcgcccccggaccgcaccgggcgttc
cacgtggccgccgggggagcggtgtgcgtccattgccggccgccgggcgccgccacgccg
tcaccgggtgtcctcgacttgatggatgcgctgatccgcggcgactgggcgagcacggac
gacgtgcccgagtcgttgcgggggcaggccagcggtctcgtcgcggcgcacctgcagtgg
cacctcgaacggcaactccgcactctcccgctgatcgaacgcgcacgaccgcatgcggcg
gtaggggtggaggattcggtcaggcaggatggggaccgtgattcgacgacgcgaacctcg
agccccgcatag

DBGET integrated database retrieval system