KEGG   Rhodococcus opacus PD630: Pd630_LPD05387
Entry
Pd630_LPD05387    CDS       T03071                                 

Definition
(GenBank) hypothetical protein
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05387
   03430 Mismatch repair
    Pd630_LPD05387
   03440 Homologous recombination
    Pd630_LPD05387
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05387
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05387
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD05387
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD05387
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD05387
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_gamma3
Other DBs
NCBI-ProteinID: AHK32590
LinkDB
Position
complement(5566913..5567890)
AA seq 325 aa
MSTPTQLEQLHLVLGDEEFLVERAVAQVIGHVRANADVAAGAELPVNRLRAGDAGAAELA
ELLSPSLFAEDRVVVLEAAAEAGKDAVALILDAAGDPPPGVVLVVLHSGGGRAKAMTGAL
EKLGAVVHPCAKLKSGDLIGFIRGEFRTLGVRVSPEVVQSVFEGVGSNLRELAAACSQLT
ADTGGKIDVAAVQRYYSGKAEVSGFDVADKAVAGDTAGAIEALRWAMLRGVPHVLLADAL
ADAVHSIARVAPAGRGDPFRMASELGMPPWKIKKAQALAKGWTPTSVGEALRIVAALNAD
VKGASADADYAVESAVGRVSRLRQV
NT seq 978 nt   +upstreamnt  +downstreamnt
gtgagcactccaactcagctcgaacagctccatctggtcctcggtgacgaggaattcctc
gtcgaacgcgcggtggcgcaggtcatcggccacgtccgcgcgaacgcggacgtggccgcg
ggcgcggagcttcccgtcaaccggttgcgggcgggcgatgccggggcggccgaactcgcc
gaactgctcagcccctcgctgttcgccgaagaccgcgtggtggtgctggaggccgccgcc
gaggcgggcaaggacgccgtggcactgatcctcgacgcggccggcgacccgccgcccggc
gtcgtcctggtggtcctgcactcgggtggcggacgtgcgaaagcaatgaccggggcgctg
gagaaactcggagctgtggtgcacccctgcgccaaactgaagtcgggcgacctcatcggg
ttcattcgcggcgagttccgcaccctcggggtccgggtgtcgccggaagtggtgcagagc
gtgttcgaaggagtcggctcgaatctgcgcgaactggccgccgcgtgctcgcagctgacg
gccgacaccggcgggaagatcgacgtcgccgccgtgcagcggtactactcgggcaaggcc
gaggtgagcggattcgacgtcgcggacaaggccgtcgccggtgacaccgcgggcgcgatc
gaggcgctgcgctgggcgatgctgcgtggcgtgccgcacgtgttgctggctgacgcgctg
gccgacgcggtgcactcgatcgcccgggtggccccggcggggcggggagacccgttccgg
atggcgtcggaactcgggatgccgccgtggaagatcaagaaggcacaggccctcgcgaag
ggatggactcccacatcggtgggggaggcgctgcgtatcgtggccgccctgaacgccgac
gtcaagggcgcgtcggccgacgcggactacgccgtcgagagtgcggtgggccgcgtctcc
cggctacgacaggtctga

DBGET integrated database retrieval system