KEGG   Rhodococcus opacus PD630: Pd630_LPD05408
Entry
Pd630_LPD05408    CDS       T03071                                 

Definition
(GenBank) putative ATP-dependent DNA helicase recQ
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:3.6.4.12]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Pd630_LPD05408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:roa03019]
    Pd630_LPD05408
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05408
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pd630_LPD05408
Messenger RNA biogenesis [BR:roa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     Pd630_LPD05408
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Pd630_LPD05408
SSDB
Motif
Pfam: DEAD Helicase_C ResIII RecQ_Zn_bind Pribosyltran HEM4 AAA_22 DUF927
Other DBs
NCBI-ProteinID: AHK32611
UniProt: W8H443
LinkDB
Position
5587222..5589321
AA seq 699 aa
MTTATEPALRDEAERLLRELAGEHATLRDDQWTAIEALVVGRRRALVVQRTGWGKSAVYF
IAAKLLRAHGHGPTVIVSPLLALMRNQVASAERAGVRAATINSGNVTEWDDIHARVADNE
LDVLLVSPERLNNPDFRDQVLPSLAADAGLVVVDEAHCVSDWGHDFRPDYRRIRTLIAEL
GEGIPVLATTATANDRVVSDVSTQLGVGGAETLVLRGGLERESLHLSVVQIPEATARAAW
LAQKLDSLPGSGIIYALTVSAARDLASLLSEQGHTVAAYTGQTDAAERETLEQDLLGNRV
KALVATSALGMGFDKPDLGFVVHLGAPSSPISYYQQVGRAGRSTDRAEVILLPGSEDKQI
WSYFASVAFPREHVVRRVIEVLDTERPQSTQALEPLVELGRTRLEMVLKVLDVDGAVRRV
RGGWVGTGEPWTYDADRYERLERARESEQQAMIDYQRITTCRMAFLREQLDDPGLAAGAS
ECGRCDNCTGVRHDATVDAAAVQQTRTRLERPGVDLAPRKQWPTGLAKLGVTLSGKITDG
PEPGRVLGRLSDLGWGQRLRALLDEPDGPAPDAVLKACIQVLASWDWIERPTAVMAVESA
THPLLSASIAGQLAAVGRLTDLGVLRLRPEHPPVSAANSAYRVAGLVDAWEVPELPDGAG
PVLLVDTLTDTGWTLTMAARTLRAAGAASVLPFALASLK
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgacgaccgccaccgaacccgcactccgtgacgaggccgaacggctgctccgcgagctg
gcaggcgagcacgccaccctccgcgacgaccagtggacggcgatcgaggcgctcgtggtg
ggccgcagacgggcgctggtcgtccagcggacgggctggggcaagtcggcggtctacttc
atcgcggcgaagctcctgcgggcgcacgggcacggtcccacggtcatcgtgtcgccgctc
ctggccctcatgcggaaccaggtggcctccgccgagcgggcgggcgtgcgcgccgccacc
atcaattccggcaacgtcaccgagtgggacgacatccacgcccgggtcgcggacaacgaa
ctcgacgtgttgctggtcagccccgagcgtctcaacaatcccgacttccgcgaccaggtc
ctcccctccctcgccgccgacgcgggcctcgtcgtggtcgacgaggcgcactgcgtgtcg
gactggggtcacgacttccgtcctgactatcggcgtatccgcacgctgatcgccgagctg
ggcgagggcatccccgtgctggccaccacggccacggcgaacgaccgcgtcgtctccgac
gtctccacgcagctcggggtgggcggcgccgaaaccctcgtcctccgcggcggcctcgaa
cgcgagtcgctgcacctgtcggtcgtgcagattccggaggccaccgcccgggccgcgtgg
ctcgcccagaaactcgacagcctgcccggctcgggcatcatctacgcgctcaccgtgtcg
gcggccagggatctggcgagcctgctgtccgagcagggccacacggtcgccgcatacacc
gggcaaaccgacgccgccgagcgcgagaccctcgagcaggacctgctcggcaaccgggtc
aaggccctcgtggcgacgtccgcgctcggaatggggttcgacaagcccgacctggggttc
gtcgtgcacctcggtgcgccgtcgtcccccatctcctactaccagcaggtcgggcgtgcc
ggacggtccaccgaccgcgcggaggtcatcctgctgcccggatccgaggacaagcagatc
tggagctatttcgcctcggtggcgttcccccgggagcacgtggtgcggcgggtgatcgag
gtcctcgacaccgagcggccgcagtccacgcaggccctcgagccgctggtggagctcggc
cgcacccggctggagatggtcctgaaggtcctcgacgtcgacggtgccgtacgccgggtg
cgcggcggctgggtgggcaccggggagccttggacgtacgacgccgaccggtacgaacgc
ctcgaacgcgcccgcgagtccgagcagcaggcgatgatcgactaccagcggatcaccacg
tgccggatggcgttcctgcgcgagcagctcgacgatccgggtctggcggcgggcgcctcg
gagtgcgggcggtgcgacaactgcaccggagtacgccacgacgcgaccgtggacgccgcg
gcggtgcaacagaccagaacgcgcctcgagcgcccaggcgtggacctggcaccccgtaaa
cagtggcccacgggcctcgcgaagctcggcgtgacgctgtccgggaagatcacggatggc
cccgaaccggggcgcgtcctgggccggctgtccgacctgggctggggtcagcgactgcgt
gccctgctcgacgaaccggacgggcccgcccccgacgccgttctgaaggcctgcatccag
gtgctggcctcctgggactggatcgagcgtcccaccgccgtcatggccgtcgaatccgcc
actcatcccctcctgtcggcgtcgatcgcggggcaactcgccgccgtcggacgcctcacc
gacctgggagttctgcggctgcgcccggaacatccgccggtgtccgcggccaactccgcc
taccgggtggccgggctcgtcgacgcctgggaggtccccgagcttcccgacggcgccgga
ccggtgctgctcgtcgacaccctcacggacaccggctggaccctcacgatggccgccagg
acgctgcgcgcggcgggtgccgcgtcggtcctccccttcgcgctcgcgagtctcaaatag

DBGET integrated database retrieval system