KEGG   Rhodococcus opacus PD630: Pd630_LPD05501
Entry
Pd630_LPD05501    CDS       T03071                                 

Definition
(GenBank) DNA polymerase IV 2
  KO
K02346  DNA polymerase IV [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05501
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD05501
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    Pd630_LPD05501
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH EccE HHH_5 DNA_pol_lambd_f
Other DBs
NCBI-ProteinID: AHK32702
UniProt: W8H3M9
LinkDB
Position
complement(5675140..5676366)
AA seq 408 aa
MFVSDSPRPRISSGAEATILHADLDAFYASVEQRDDPGLRGRPVIVGGGVVLAASYEAKA
YGVRTASSGAQALRLCPHAVVVRPRMSAYAAASKAVFEVFGRTTPLVEGLSIDEAFLDVA
GLRKIAGAPVDIAARLRRDVREQVGLPITVGIARTKFLAKVASAVGKPDGLLHVPPDHEI
EFLHPLPVERLWGVGAVTSVKLRDAGIATVGQLAHYPEELLVSVVGPAAGHHLHALAWAR
DPRPVQVGRRRRSVGAQHALGRRPKSREDVDAALVTLVDRVAGRLRRGKRVGRTVVLRLR
FDDFTRVTRSHTLAQPSAQTQTILTTARGLLNNAMPMIERQGITLVGVAVANLEDDCPQQ
LALPFDPYTSSSLDSTLDSLRDRFGSSAVTRAVLLGRDQGVTVPILPD
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgttcgtgtccgattcgccgcgcccgcgcatctcgagtggcgccgaggcgaccatcctg
cacgccgacctcgatgcgttctacgcctcggtggagcaacgggacgaccccggcctgcgg
gggcgtccggtgatcgtcggtggcggcgtcgtgctggccgcgagctacgaggcgaaggcg
tacggggtgcgcaccgccagcagcggtgcgcaggcgctgcgcctgtgcccgcacgccgtc
gtggtgcgcccacgaatgtcggcgtatgcggccgcgagcaaggcggtgttcgaggtgttc
ggccggacgacgcccctggtcgagggactgtcgatcgacgaggccttcctcgacgtcgcc
ggtctccgcaagatcgcgggcgcgccggtcgacatcgcggcgcgtctgcgccgcgacgta
cgcgagcaagtgggtctgccgatcacggtcggaatcgcgagaacgaagttcctcgccaag
gtcgccagcgcggtgggcaaacccgacggactgttgcacgtgccgccggaccacgagatc
gagttcctccatccgctgccggtcgaaaggctgtggggtgtcggggcggtgacgtcggtc
aagctccgcgacgccgggattgccaccgtcgggcagctcgcccactatcccgaagagctg
ctcgtgtccgtcgtcggacccgcggcgggccaccacctccacgcgctcgcgtgggcacga
gatccacgtcccgtgcaggtggggcgcaggcggagatccgtcggcgcgcagcacgctctg
gggcgcagaccgaagtcgagggaggacgtggacgccgcgctggtgacgttggtcgaccgg
gtggccggccggctgcgccgcggcaagcgggtcgggcgcacggtggtgctccggctgcgg
ttcgacgacttcacccgggtcacgcgttcgcacacactcgcgcagccgtcggctcagacg
cagacgatcctcacgacggcccggggcctgctgaacaacgcgatgccgatgatcgaacgc
cagggcatcaccctcgtcggagtcgcggtggccaacctcgaggacgactgcccgcaacag
ctggcgctgccgttcgacccgtacacgagcagttcgctcgacagcacgctcgacagcctc
cgcgaccgcttcggttcctcggccgtcacccgcgcggtgctgctgggccgggatcagggt
gtgacggtgccgatcctgccggactag

DBGET integrated database retrieval system