KEGG   Rhodococcus opacus PD630: Pd630_LPD05515
Entry
Pd630_LPD05515    CDS       T03071                                 

Definition
(GenBank) Single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05515
   03430 Mismatch repair
    Pd630_LPD05515
   03440 Homologous recombination
    Pd630_LPD05515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05515
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05515
   03029 Mitochondrial biogenesis [BR:roa03029]
    Pd630_LPD05515
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Pd630_LPD05515
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     Pd630_LPD05515
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pd630_LPD05515
Mitochondrial biogenesis [BR:roa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    Pd630_LPD05515
SSDB
Motif
Pfam: SSB tRNA_anti-codon
Other DBs
NCBI-ProteinID: AHK32716
LinkDB
Position
complement(5690730..5691158)
AA seq 142 aa
MYETHGTVVGTVITGPVTRSNAAGDEFLSFRMASTVRRRDHATGEWRDGSTLYLTVTCRR
RLMAGVDQSIAKGDPVIVTGELRTTEYTTRDGIARSDLELSATAIGPDLARCTVVLERAP
RTGDGGAATQATEQVATRSLVA
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtacgaaacacacggcaccgtggtcggaacggtcatcaccggcccggtcacccggtcg
aatgcggccggtgacgagttcctcagtttccggatggcgagcacggtccggcgccgtgat
cacgcgacgggcgagtggcgcgacgggagcacgctctacctcacggtgacctgcaggcgg
cgactgatggccggtgtcgaccagtcgatcgcgaagggggatccggtgatcgtgaccggc
gagttgcgcaccacggagtacacgacgcgggacggcatagcccgctccgacctggagctg
agtgcgaccgcgatcggaccggatctcgcccggtgcacggtcgtcctcgagcgcgcgccc
agaaccggggacgggggtgcggcgacccaggcgacggaacaggtcgccactcggtccctc
gtcgcgtag

DBGET integrated database retrieval system