KEGG   Rhodococcus opacus PD630: Pd630_LPD05568
Entry
Pd630_LPD05568    CDS       T03071                                 

Definition
(GenBank) putative ATP-dependent helicase dinG
  KO
K03722  ATP-dependent DNA helicase DinG [EC:3.6.4.12]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05568
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pd630_LPD05568
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    Pd630_LPD05568
SSDB
Motif
Pfam: Helicase_C_2 DEAD ResIII DEAD_2
Other DBs
NCBI-ProteinID: AHK32765
LinkDB
Position
5741028..5743076
AA seq 682 aa
MPENLPNVPELLRTAVRSLGGAERSNQLTMASAVAHSIDTGEHLAVQAGTGTGKSLAYLV
PSVRHAVQSGKTVIVSTATIALQRQLIDRDMPRLADALEGSLGRRPHFAILKGRNNYLCM
NKIHTGSAEEPPTDELFDPFAVSRLGREVQRLTEWSSDTETGDRDDLAPGVSDKAWRQVS
VTARECLGKSRCPVGEDCFAERARAEASQVDVVVTNHALLAIDAITGIAILPEHDVVVID
EAHELVDRVTNVATAELAASTISAAARRCAKLVEEQDADRLEAAGEGWAALLEELRPERW
EALPPGAAPALAAVRDAAWSLRTAIGPSRPGMALSDPEAAAARNTALASVEEVHDSAVRV
LSAFDEPDPAKRHDVVWLAADDNRGSIRRVVRMAPLSVGGLLRSRLFAESTVVLTSATLT
VGGSFDGLAVNWGLPAESSVVIDPAMATGSEAPSDSGTLKWNALDVGSPFDHARAGIIYI
AKQLPPPGRDGLSPTYLDEIAELVEAAGGRTLGLFSSMRAAKAASEAMRDRLDTPILCQG
DDSTGALVRAFAGDEPTSLFGTLSLWQGVDVPGPSLSLVILDRIPFPRPDDPLLVARQKA
VESRGGNGFLSVAANHAALLLAQGVGRLLRSVDDKGVVAVLDPRLATARYAGYLRASLPP
FWETSDPEVVRKALGRIRDSRP
NT seq 2049 nt   +upstreamnt  +downstreamnt
gtgcctgaaaacctccccaacgtccccgagctgttgcgcacggcggtgcggtcgctgggc
ggtgccgagcggtccaaccagctgaccatggcttccgccgtcgcgcattcgatcgacacc
ggggagcatctggccgtccaggccgggactggcaccggcaagtccctcgcctatctggtg
ccgagcgtccggcatgcggtgcagagcgggaagacggtcatcgtctcgacggccaccatc
gcactgcagcgtcagctgatcgaccgcgacatgccgcggctcgcggacgcgctcgaaggc
tcgctcggacggagaccgcacttcgcgatcctcaagggccgcaacaactatctgtgcatg
aacaagatccataccgggtccgccgaggagcctcccacggacgagctgttcgacccgttc
gcggtgtcgcggctcggacgggaggtccagcgcctcaccgagtggtcctcggacaccgag
accggcgaccgcgacgacttggcccccggagtcagcgacaaggcgtggcgccaggtcagc
gtcaccgcccgcgaatgcctcggcaagtctcggtgcccggtcggcgaggactgcttcgcg
gagcgggcccgcgcggaggcctcgcaggtcgacgtcgtggtcacgaaccacgccctgctc
gccatcgacgccatcaccgggatcgcgatcctccccgaacacgacgtcgtggtcatcgac
gaggcgcacgaactggtcgaccgcgtcacgaacgtcgccaccgcggagttggcggcgtcg
acgatcagtgccgcggcgcggcgctgcgcgaagctcgtcgaggagcaggacgcagaccgc
ctcgaggctgcgggcgagggctgggccgcgctcctcgaggagttgcggccggaacggtgg
gaggcgttgccgcccggcgcggcccccgctcttgccgcggtccgcgacgccgcctggtcg
ctgcgcacggcgatcgggccgtcccgtcccggtatggcgttgagcgacccggaggccgcg
gcggcacgcaacaccgcactcgcctcggtcgaggaggtacacgacagcgccgtccgcgtt
ctcagcgccttcgacgagccggatccggccaagcgtcacgacgtggtgtggctggccgcc
gacgacaatcgcgggtcgatccgccgggtggtgcggatggcgccgctgtcggtcggcggg
ctgctgcgttcccggctgttcgccgaatcgaccgtggtcctgacgtccgccacgctgacc
gtgggcggatcgttcgacggcctggcggtcaactggggacttccggccgaatcgtccgtc
gtgatcgatccggcgatggccaccggctccgaggcgccgtccgattcgggcacgctcaaa
tggaacgccctcgatgtcgggtcgccgttcgaccatgcccgcgccggcatcatctacatc
gcgaagcaacttccgccgccggggcgggacggcctgtcccccacgtatctcgacgagatc
gccgaactcgtcgaggcggcgggcgggcgcacgctgggattgttctcctcgatgcgggcc
gccaaggccgcgtccgaggcgatgcgcgaccggctcgacaccccgatcctgtgccagggc
gacgactcgacgggcgccctcgtccgggcgttcgcaggcgacgagccgacgtcgcttttc
ggcacgctgtcgctgtggcagggtgtcgacgtgccgggaccgtcgctgagcctcgtgatc
ctcgaccgcatccccttcccccgccccgacgacccgttgctggtcgcccggcagaaggcc
gtcgagtcgcgcggcggaaacgggttcctttccgtcgcagccaatcacgcggcgctgctg
ctcgcccagggtgtgggacgtctgctacgcagcgtcgacgacaagggtgtggtggccgtc
ctcgatccgcggctcgccacggcccgctacgccgggtatctgcgggcctcgctgccaccg
ttctgggagacgtccgatccggaagtcgtgcgtaaggcactggggcggatccgcgattcg
cgcccgtga

DBGET integrated database retrieval system