KEGG   Rhodococcus opacus PD630: Pd630_LPD05785
Entry
Pd630_LPD05785    CDS       T03071                                 

Definition
(GenBank) putative DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03410  Base excision repair
roa03420  Nucleotide excision repair
roa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05785
   03410 Base excision repair
    Pd630_LPD05785
   03420 Nucleotide excision repair
    Pd630_LPD05785
   03430 Mismatch repair
    Pd630_LPD05785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05785
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05785
Enzymes [BR:roa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pd630_LPD05785
    6.5.1.6  DNA ligase (ATP or NAD+)
     Pd630_LPD05785
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Pd630_LPD05785
DNA replication proteins [BR:roa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    Pd630_LPD05785
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     Pd630_LPD05785
DNA repair and recombination proteins [BR:roa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Pd630_LPD05785
   NER (nucleotide excision repair)
    Other NER factors
     Pd630_LPD05785
   MMR (mismatch excision repair)
    Other MMR factors
     Pd630_LPD05785
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Other DBs
NCBI-ProteinID: AHK32976
LinkDB
Position
5963579..5965090
AA seq 503 aa
MLFSQIVATSRDVGATRSRKVKVGALREVLTQLEPAEVEPVVAWLSGELRQGRIGIGWRT
IADIPATPADVPSVTVSELDGTVTAVAGISGSGSAARRRELLVDLFARTTADERDFLLRL
LTGDLRQGALEGVMTDAIAAAADLPVEPVRRAFMLSGRLPATAVAAFDGGVDALTAFRLE
VGRPVRPMLASPAESLTDAWTELGGDVSVEYKLDGARIQVHRNGDEVRIFTRTLREITGS
VPELVALVAGLPCTSAVFDGETLALTDSGRPRPFQETMSRFGAESARDLLLHPYFFDCLH
LDGVDLLDAPLEERLDALERVAPQHRIPGLIRPDSDGAATHFDDALAAGHEGVMVKSLAA
PYAAGRRGRAWQKVKPEHTLDLVVLGAEWGYGRRTGYLSNLHLGARDPDGGEPIMVGKTF
KGLTDALLQWQTDEFPRHERSRDDHTVYLHPDLVVEIELDGVQVSTRYPGGLALRFARVL
RYRPDKTAADADTIDAVRALLPG
NT seq 1512 nt   +upstreamnt  +downstreamnt
gtgctgttctcgcagatcgtcgcgacgtcccgggacgtgggtgccacccggtcgcgcaag
gtgaaggtcggggcgctgcgcgaggtcctcacccaactggagccggccgaggtggaaccg
gtggtggcgtggctgtccggggagcttcggcagggacggatcgggatcggctggcggacg
atcgccgacattcccgccaccccggccgacgtcccgtccgtgacggtgtcggaactcgac
gggactgtcaccgccgtcgccgggatctccggttccggatccgccgcccgccgacgcgaa
ctgctcgtggacctcttcgcccgcaccaccgccgacgagcgggacttcctgctgcgactg
ctcaccggcgaccttcgtcagggcgcgctcgagggggtgatgaccgacgcgatcgcggcg
gccgccgatcttcccgtcgaaccggtgcgccgcgcgttcatgctgtcgggacggctgccc
gcgaccgcggtcgcggcgttcgacggcggggtggacgccctcaccgcgttccggctggag
gtgggtcgtccggtccggcccatgctcgcctcccccgctgaatcactcaccgacgcgtgg
accgaactcggcggcgacgtcagcgtcgaatacaaactcgacggggcgcggatccaggtg
caccgcaacggcgacgaggtgcgcatcttcacccgcaccctgcgtgagatcaccggcagc
gtgccggaactcgtcgcactcgtcgccggcctgccctgcacgtctgcggtgttcgacggg
gagacgctggcgctcaccgacagcggccggccccgtccgttccaggagacgatgagccgc
ttcggcgccgagtccgcccgcgacctgctgctgcacccctatttcttcgactgcctgcac
ctcgacggcgtcgatcttctcgacgcgccgttggaggagcggctggacgcgctggaacgc
gttgccccgcaacaccgcatccccgggctgatccgccccgacagcgacggcgccgcaacc
catttcgacgacgcccttgccgccggtcacgaaggggtgatggtcaagtcgcttgccgct
ccgtatgcggcgggtcgacgcggccgcgcctggcagaaggtgaaaccggagcacacactc
gacctggtggtgctcggcgccgaatggggttacgggcggcgcaccggctacctgtccaac
ctgcacctcggtgcgcgcgacccggacggcggcgaaccgatcatggtgggcaagacgttc
aagggcctcaccgacgcgcttctgcagtggcagacggacgaattcccacgccacgaacgc
agccgcgacgatcacaccgtgtacctgcaccccgacctcgtcgtggagatcgaactcgac
ggcgtccaggtcagcacgcgctaccccggcggactcgcgctgcgattcgcgcgggtcctg
cgctaccgccccgacaagaccgccgccgacgccgacaccatcgacgccgtgcgggccctg
ctgccgggctga

DBGET integrated database retrieval system