KEGG   Rhodococcus opacus PD630: Pd630_LPD06002
Entry
Pd630_LPD06002    CDS       T03071                                 

Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD06002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD06002
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pd630_LPD06002
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD06002
SSDB
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 UvrD-helicase SH3_13 AAA_22 UvrD_C AAA_25
Other DBs
NCBI-ProteinID: AHK33193
LinkDB
Position
complement(6223200..6225068)
AA seq 622 aa
MTEVQVAQRGKGMLRVFNEAGVLAAADVHVALRLSALGGESSEDVVLATALAVRAVRSGS
VCLDLTRIREVTVDEESEVDLDALPWPDDGTVVEALRRSPLVAGGSAGPLRPLRLVDTAE
GGLLYLDRYFRQEATIRRVLDQRAVGHPLVDEQSLQEGLDALFRDQHDHGAPAPAPDRQR
IAAAVAATQWTSVVVGGPGTGKTHTVARVLALLTRQPGPGLRIALAAPTGKAAARLQESV
REQSDALGLPSDLTAMTLHRLLGWQRGRGSRFRYNANNHLPYDAIVVDETSMVSLTMMCR
LLEAVRPDTRLVLVGDPDQLTSVDAGAVLADLVARPVTGTENPVLARIVGADLEAADDPL
EAALSAGERDRLRGGVVRLSRGRRFGGGIAQLAVAVRKGEPDEVMEILSSGFPEVSFHGP
EDLDALRTDVVGTAAAVTAAAESGDALAALRHSEEHRLLCAHREGPYGVQRWARQAMEWM
GEATGQRLNPDRWYPGQPLMVTANDHETKIYNGDTGVIVRRDDDELVAAFVRGHEPFLLH
PTHLSAVQTVYAMTIHRSQGSQYDTVSVVLPGEASSLLTRELLYTAITRARKHVRIIGSE
DAVRAGVQRRVLRASGLRRAIP
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaccgaggtgcaggtggcgcagcgcggcaaggggatgctgcgggtcttcaacgaggcc
ggtgtgctggccgccgcggacgtgcacgtcgcgttgcggttgtcggcgctcggaggcgaa
tcgtcggaagacgtcgtactggcgacggcgctggcggtgcgggcggtgcggtccggctcg
gtgtgcctggacctgacgcggattcgtgaggtgaccgtcgacgaggagtccgaagtcgat
ctcgacgcactgccgtggccggacgacggcaccgtcgtcgaggcactgcggcggagcccg
ctggtcgcgggtggttcggcgggtccgctgcgaccgctgcggctcgtcgacacggccgag
ggcgggctgctctacctcgaccggtacttccggcaggaagcgaccatccggcgggtactc
gaccagcgcgccgtcgggcatcccctcgtcgacgagcagtcgctgcaggagggcctggac
gcgttgttccgcgaccagcacgaccacggggcgccggccccggctccggatcggcagcgg
atcgccgccgcggtcgccgccacacagtggacgtcggtggtggtcggcggacccggaaca
ggcaagacgcacaccgtcgcccgggtgctggcgctgctgaccaggcagcccggcccgggc
ctccggatcgcgctcgccgcacccaccgggaaggccgcggcgcggttgcaggaatcggtg
cgcgagcagtccgacgcactcgggttgccgtccgacctgaccgcgatgacgctgcatcgg
ctgctgggctggcagcgcggacgtggtagccggttccgctacaacgcgaacaatcacctg
ccttacgacgcgatcgtggtcgacgagacgtcgatggtgtcgctgacgatgatgtgccgg
ctcctcgaggcggtccgcccggacacccggctggtgctcgtcggcgaccccgatcagctg
acctccgtcgacgcgggcgcggtcctggccgatctcgtggcccggccggtgacgggaacc
gagaatccggtgctcgccaggatcgtcggcgccgacctggaggcagccgacgacccgctc
gaagccgccttgagtgcgggagaacgggacagattgcggggcggagtggtgcggctcagc
cgcgggcggcggttcggcggcggcatcgcgcagctggccgtcgcggtacggaagggcgaa
ccggacgaggtcatggagatcctgtcgagcggtttccccgaggtgtcgttccacggtccc
gaagacctggacgcactgcggacggacgtggtggggacggccgccgcggtcaccgcagcc
gcggaatccggtgatgcccttgctgcactgcggcattcggaggagcatcgcctgttgtgc
gcgcaccgggaaggtccgtacggcgtgcagcggtgggcgcggcaggcgatggagtggatg
ggggaggcgacggggcagcggctgaacccggatcgctggtatccgggccagccgctgatg
gtgactgccaatgatcacgaaacgaagatctacaacggcgacaccggggtgatcgtgcgc
cgcgacgacgacgaactcgtcgccgcattcgtgcggggccacgaaccgttcctgttgcat
ccgacgcatctgtccgcggtgcagacggtgtacgcgatgacgattcaccgcagtcagggc
agtcagtacgacacggtgtccgtggttcttcccggcgaggcgtcgtcgctgctgactcgc
gaattgctgtacaccgcgatcacccgtgcacggaagcacgtgcggatcatcgggtccgag
gatgcagtgcgggcgggagtgcaacgccgggtgctgagggcgagtgggcttcggagggcg
attccgtag

DBGET integrated database retrieval system