KEGG   Rhodococcus opacus PD630: Pd630_LPD06003
Entry
Pd630_LPD06003    CDS       T03071                                 

Definition
(GenBank) Exodeoxyribonuclease V beta chain
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD06003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD06003
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pd630_LPD06003
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD06003
SSDB
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 AAA_30 PDDEXK_1 AAA_11 ResIII
Other DBs
NCBI-ProteinID: AHK33194
LinkDB
Position
complement(6225065..6228376)
AA seq 1103 aa
MTGARGFDLLGPLPEGTTVLEASAGTGKTYAIVGLAARFVAEGGVDLSQLLLVTFSRAAT
QELRERTRERFGSAAAALADPAAARLSADQLIRHLAEADTDEVTLRRRRLLQALSDFDAA
TIVTTHSFCQRMLDGLGIAGERDPDTVLVEAADDLTTEVIADLYLRAYSRVEAAPFTPAE
ATAAARAAIFDPQAVLAPEDARGTPAGDRVAFAEAVRAEVERRKRAVGLRDFDDLPMLLH
RVLSDPEHGAAACRRVRERYGVVLVDEFQDTDPLQWDILRRTFHGSGTLVLVGDPKQAIY
AFRGAEVLSYLDAVRSADRHQELTTNWRSDQELLDGLEYLHGGAALGHTDIVVHRVDGAR
PKSRLTGTVPLRLRYLPRTGAGPINKSGYPAVGPLRKRIAADLAADIVALLDGGATLDVG
GSIRLVEPGDIAVLVRTNAQITLVHDALDRAGVPSVLAGGASVFTTPAAQHWLWLLQAIE
QPHRSDRVRLAALTPLLGHTAEELDARGDDIVAEVGGQLRELGDVFAQSGFAALFERLSA
VGALEARLLRVAAGERALTDLRHVAQLLNGAAVEQSLGLTAVTRWLTERMKDPSSGGVDR
SRRLDSDAAAVQIATVHASKGLEFPLVYLPYAWDAAKISKPSKLLLHDDDGRRILDVGGP
GSPGYADRRNRHDAEEAGEELRLLYVAVTRAMCGLVVWWAPAFTTAGAPLHRIILGRQPG
QREVPPKVTVPEDPVVAERLSAWGAEAPETVTVEAVGSDPIARVEWTPQREPHGDLEAAR
FRRLLDTRWRRTSYSALTASAHDAPAVGSEAEVEEKTDEPAEPPLQVPADVTAGVPSTMN
ELPGGATFGTLVHAVFEIVDTAAPDLDAEVLRCCRDVIASTLSDIDPAQLATALLPVLRT
PLGAGGEPTLADIAPADLLAELDFELPLAGGDTPSLTVMLDGVGRLLRTHLPVDDPLRSY
ADAVQTLEPTPLRGYLTGSIDVVLRLPGPRYVVVDYKTNRLAQGDLTTAHYTRERMAAEM
LRAHYPLQALLYSVALHRYLRWRQPDYDPAVHLGGVRYLFVRGMVGPGTPPGCGVFDWAP
PAALITELSDLLSGSASEREGTR
NT seq 3312 nt   +upstreamnt  +downstreamnt
gtgaccggcgcgcgaggcttcgacctcctcggtccgctgccggaggggacgacggtgctc
gaggcgagcgccggtaccggcaagacgtacgcgatcgtcggtctggccgcccgcttcgtc
gccgaggggggcgtggacctgtcgcagctgttgctggtgacgttcagccgggcggccacg
caggagctgcgggaacgcacccgtgaacgattcggttccgcggcagccgcattggccgat
cccgcagcggcgcggctgagcgcggatcaactgatccggcatctcgccgaagccgacacc
gacgaggtgacgctgcgccgccggcgcctgctgcaggcgctgtcggacttcgacgccgcc
accatcgtcaccacccacagcttctgtcagcgcatgctcgacgggctcggcatcgcgggc
gaacgcgaccccgacacggtgctggtcgaggccgccgacgacctcacgacggaggtgatc
gccgacctgtacctgcgggcctacagtcgggtcgaggccgcgccgttcactccggcggag
gccaccgcggccgcccgggccgccatcttcgacccgcaggcggtgctcgccccggaagat
gcgcggggcaccccggccggggatcgggtggcgttcgccgaggcggtgcgcgccgaagtc
gagcggcgcaaacgtgcggtgggtctgcgtgacttcgacgatctcccgatgctgctccat
cgcgtcctcagcgatcccgagcacggtgcggcggcctgccggcgggtccgcgaacgctac
ggcgtcgtgctcgtcgacgagttccaggacaccgacccgctgcagtgggacattctgcgc
cgaacgttccacggcagcggaacgctggtgctcgtcggcgacccgaagcaggccatctac
gcattccgtggggcggaggtgctcagctacctggacgcggtgcggtcggcggaccgtcac
caggagttgaccaccaactggcgcagcgatcaggaactcctcgacgggctcgaatatctg
cacggcggcgccgcgctcgggcataccgacatcgtggtgcaccgcgtcgacggtgcgaga
ccgaagtcgcgtctgacgggtaccgtgccgctgcggctgcggtatctgccgaggaccggc
gccgggccgatcaacaagtcgggataccccgcggtggggccgctccggaagcggatcgcg
gcagacctcgcggccgacatcgtcgccctcctcgacggtggcgcgacactcgacgtcggg
gggagcatccgactcgtcgaacccggcgacatcgccgtcctggtccgcaccaacgcgcag
atcacgctggtccacgacgccctcgaccgggcgggtgtgccgtccgtgctcgccggcggg
gccagcgtcttcacgactccggctgcgcagcactggctctggcttctgcaggccatcgag
caaccgcaccgttccgaccgggtgcggctggccgcgctcaccccgctgctcggacacacc
gccgaggaactcgacgctcgcggcgacgacatcgtcgccgaggtcggcgggcagctccgc
gagctcggcgacgtgttcgcgcagtccggtttcgcggcgctgttcgaacggctgtccgcg
gtcggcgcgctcgaggcgagactgcttcgggtggcggcgggcgagcgggcactgaccgat
ctccggcacgtcgcgcagttgctcaacggtgccgccgtcgagcagtcgctcggtctgacg
gccgtcacccgctggctcaccgaacggatgaaggatccgtcctcgggtggggtggaccgc
agccgacggctcgacagtgacgccgcagcggtgcagatcgcgaccgtccacgccagcaag
ggcctcgaattcccgctcgtctacctgccgtacgcctgggacgccgcgaagatctcgaaa
ccgagcaaactgctgctgcacgacgacgacgggcgacgcatcctcgatgtcggcggtccg
ggcagccccggttacgcggaccgcaggaaccggcacgacgccgaagaggcgggggaggag
ttgcggctgctgtacgtcgccgtgacccgggcgatgtgcgggctcgtggtgtggtgggca
ccggcgttcacgacggcgggcgcaccgctgcaccgaatcatcctggggcggcagcccggg
cagcgggaggtcccgccgaaggtcaccgtccccgaggatccggttgtcgcggaacggttg
tccgcgtggggtgcggaagctccggagacggtgaccgtcgaggcggtgggttccgacccg
atcgcgcgggtcgagtggacaccacaacgtgagccccacggagacctggaagccgcgcgt
ttccggcggctgctcgacacgcgctggcgtcgcacgtcgtattcggcgttgaccgcgtcc
gcgcacgacgcgcccgcggtgggcagtgaggccgaggtcgaggagaagacggacgaaccg
gccgagcctccgttgcaggtgccggccgacgtcacggcgggggtgccgtcgacgatgaac
gaactgcccggcggcgcgacgttcggcacgctcgtgcacgccgtcttcgagatcgtcgac
accgcggcacccgatctggacgcagaagtcctgcggtgctgccgcgacgtgatcgcgtcg
accctgtcggacatcgaccccgcccagctggcgacggcgctgctgcccgtgctgcggact
cccctcggcgcggggggcgagccgacactcgccgacatcgcacccgcagacctgctggcg
gagctcgacttcgaactgccgctcgccggtggcgacacaccctcgctcaccgtgatgctc
gacggcgtcggcaggctgctgcgcacccaccttcccgtcgacgatccgctgcggtcgtac
gccgatgccgtgcagacactcgaaccgaccccgctgcgcggatacctcaccggcagcatc
gacgtcgtgctgcgattgcccggaccgcggtacgtcgtggtcgactacaagaccaatcgc
ctcgcgcagggcgacctgaccaccgcgcactacacccgcgagaggatggccgccgaaatg
ttgcgggcacactacccgctgcaagcgttgctgtattccgttgcgttgcatcgctatctg
cgctggcggcaaccggactacgatccggcggtgcacctcgggggcgtccggtatctgttc
gttcgcggaatggtcggccccggcaccccacccggctgtggtgtcttcgactgggcgccg
cccgccgcgctgatcaccgagctgtccgatctgctgtccgggtcggcctccgagcgcgag
gggacgcgatga

DBGET integrated database retrieval system