KEGG   Rhodococcus opacus PD630: Pd630_LPD06062
Entry
Pd630_LPD06062    CDS       T03071                                 

Definition
(GenBank) putative endonuclease 4
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Pd630_LPD06062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD06062
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     Pd630_LPD06062
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     Pd630_LPD06062
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AHK33252
LinkDB
Position
6288970..6289740
AA seq 256 aa
MRIGAHVRQDEDPIGYGETLGADVIQMFLTDPQKWDKPPTHPRTDEIRNSPIDVVVHSSY
VINVASLNNRLRMPSRNAVAQQAQAAADIGAFGLVVHGGHVRDGEDVNAGIVNWRKLFER
QADKGGFPVPILIENTAGGDFAMARHFDAIDRLWQEVGDFGAGFCLDTCHAWAGGEELVG
VVERIKAITGRIDLVHLNNSRDEFNSARDRHANLADGTIDAELLAEVVRTADAPVVLETP
AEGLAEDLAYLRETVG
NT seq 771 nt   +upstreamnt  +downstreamnt
atgcgcataggagcacacgtccgccaggacgaagatccgatcggatacggcgaaacgctc
ggcgccgacgtcatccagatgttcctcacggacccgcagaagtgggacaaaccgccgacg
catccgcggaccgacgagatccggaacagccccatcgacgtcgtcgtgcactcgtcgtac
gtgatcaacgtggccagcctcaacaaccggctccggatgccgtcccgcaacgccgtcgcg
cagcaggcccaggccgccgccgacatcggtgcgttcgggctggtggtccacggtggccac
gtccgcgacggagaggacgtgaacgcggggatcgtcaactggcgcaaacttttcgaacgc
caggccgacaagggcggattcccggtccccatcctgatcgagaacacggcaggcggcgac
ttcgcgatggcacggcacttcgacgccatcgaccggctgtggcaggaggtcggcgatttc
ggcgccggattctgcctcgacacctgtcacgcgtgggcgggcggtgaggaactggtgggc
gtcgtcgaacgcatcaaggccatcaccggacgcatcgacctggtgcacctcaacaactcc
cgcgacgaattcaactcggcccgcgaccggcacgccaacctcgccgacggaaccatcgac
gccgaactgctcgccgaggtcgtgcgcaccgccgatgcgcccgtcgtcctcgaaacgccg
gcggaggggctggccgaggacctcgcgtacctgcgggaaaccgtaggttag

DBGET integrated database retrieval system