KEGG   Rhodococcus opacus PD630: Pd630_LPD06131
Entry
Pd630_LPD06131    CDS       T03071                                 

Definition
(GenBank) DNA-directed RNA polymerase subunit beta'
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    Pd630_LPD06131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:roa03021]
    Pd630_LPD06131
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD06131
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     Pd630_LPD06131
Transcription machinery [BR:roa03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     Pd630_LPD06131
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      Pd630_LPD06131
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-ProteinID: AHK33322
LinkDB
Position
complement(6354833..6358789)
AA seq 1318 aa
MLDVNFFDELRIGLASAEDIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWEC
YCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDL
APKDLEKIIYFAAYVIVGVDEELRHNELSTLEAEMQVEKKSVADQRDADLEARAQKLEAD
IAELEAEGAKSDVRRKVKDGGEREMRQLRDRAQRELDRLDEIWTTFTKLSVKQLIVDELL
YRELVDRYGEYFTGAMGAESIQKLMESFDIDAEAENLRETIRSGKGQKKLRALKRLKVVA
AFQVNQNSPMGMVLNAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDL
GAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRFRQNLLGK
RVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
AQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQ
MAVHLPLSAEAQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYHLTRLDEGAIGELA
ASTSDEAEQGVYSSPAEAQMAVDRGALVVQAKIKVRLTQQRPPRDIESELFPEGWNYGDG
WTAETTLGRVLFNELLPADYPFVNEQMPKKRQATIINDLAERYPMIVVAQTVDKLKDAGF
YWATRSGVTVSISDVLVPPEKAQIMESFEAQADQIEKKYQRGALNKTERNSALVKIWSEA
TDEVGKAMEAHFPDDNPIPMIVKSGAAGNMTQVRSLAGMKGLVTNPKGEFIPRPIKSSFK
EGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREVDCGTERGIVTTI
AEKQADGTLIRDAHVETSTYARTLAADAVDENGNVIVERGHDLGDPAIDALLEAGITQVK
VRSVLTCTTGTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVA
GDDITGGLPRVQELFEARVPKGKAPIADVSGRVQLEDGDRFYKITIVPDDGGEEVVYDKL
SKRQRLRVFKHDDGTERLLADGDHVEVGQQLMEGAADPHEVLRVMGPRQVQIHLVNEVQE
VYRSQGVSIHDKHIEVIVRQMLRRVTIIDSGATEFLPGSLTERADFEAANRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLIGLKENVIIGKLIPA
GTGINRYRNIQVQPTEEARAAAYAVPSYDDQYYSPDGFGQNTGAAVPLDDYGFSNDYR
NT seq 3957 nt   +upstreamnt  +downstreamnt
gtgctcgacgtcaacttcttcgatgaactccgcattggcctcgccagtgcagaggacatc
cgcaattggtcctacggcgaggtcaagaagccggagaccatcaactaccgcacgctcaag
cccgagaaggacggcctcttctgcgagaagatcttcggccccacccgggactgggagtgc
tactgcggtaagtacaagcgtgtccgcttcaagggcatcatctgtgagcgctgcggtgtc
gaggtgacccgcgccaaggttcggcgtgagcgcatgggccacatcgaactggctgccccg
gtcacgcacatctggtacttcaagggcgtgcccagccgtctcggctacctgctcgacctg
gcgccgaaggatctcgaaaagatcatctacttcgccgcgtatgtcatcgtcggtgtcgac
gaggaactgcgtcacaacgagctgtccactctcgaagccgagatgcaggttgagaagaag
tccgtcgcggatcagcgtgacgccgacctcgaggcccgcgctcagaagctcgaagccgac
atcgccgagctggaggcggagggcgcgaagtccgacgtccgccgcaaggtcaaggacggc
ggcgagcgcgaaatgcgtcagctccgtgaccgcgcgcagcgcgagctggatcgtctcgac
gagatctggaccacgttcaccaagctgagtgtcaagcagctcatcgtcgacgaactgctg
taccgcgagctcgtcgaccgctacggcgagtacttcacgggcgccatgggtgccgagtcg
atccagaagctcatggagagcttcgacatcgacgccgaggccgagaacctccgcgagacc
atccgcagcggcaaggggcagaagaagctccgcgcactgaagcgtctcaaggtcgtcgca
gccttccaggtcaaccagaactcgcccatgggcatggttctgaacgccgtcccggtgatc
ccgccggagctgcgtccgatggttcagctcgacggtggccgcttcgccacctccgacctg
aacgacctgtaccgccgcgtgatcaaccgcaacaaccgcctcaagcgactgatcgacctc
ggtgcccccgagatcatcgtcaacaacgagaagcggatgctgcaggagtccgtggacgcg
ctgttcgacaacggccgtcgtggccgtcccgtcacgggtcccggtaaccgtccgctgaag
tccctgagcgacctgctcaagggcaagcagggtcgtttccgtcagaacctgctcggtaag
cgcgtcgactactcgggtcgttccgtcatcgtcgtcggcccgcagctcaagctgcaccag
tgcggtctgccgaagttgatggctctcgagctgttcaagccgttcgtgatgaagcgcctg
gtcgacctgaaccacgcgcagaacatcaagtccgccaagcgcatggtggaacgtcagcgc
gcacaggtgtgggacgtcctcgaagaggtcatcgccgagcaccccgtgctgctgaaccgt
gcaccgacgctgcaccgcctgggcatccaggccttcgagccgcagctggtcgagggtaag
gccattcagctccacccgctggtgtgtgaggccttcaacgccgacttcgacggtgaccag
atggccgtgcaccttccgctgtccgcggaggcgcaggccgaggctcgcatcctgatgctg
tcgtcgaacaacatcctgtcgcccgcgtcgggtcgaccgctcgccatgccccgtctggac
atggtcaccggtctgtaccacctgacccggttggacgagggtgcgatcggcgagctcgca
gcgtcgaccagcgacgaggcggagcagggcgtgtactcctcgcctgccgaggctcagatg
gccgtcgatcgtggcgcgctcgtcgtgcaggcgaagatcaaggtgcggctcacgcagcag
cgcccgccccgcgacatcgagtcggagctgttccccgagggctggaactacggtgacggc
tggaccgcggagacgacgctgggtcgcgtgctcttcaacgagctgctgcccgcggactac
ccgttcgtcaacgagcagatgccgaagaagcgtcaggcgacgatcatcaacgatctcgcc
gagcgctaccccatgatcgtggtcgcgcagaccgtcgacaagctgaaggacgccggtttc
tactgggccacgcgttcgggtgtgacggtctcgatctccgacgtcctcgtgccgccggag
aaggctcagatcatggagtccttcgaggctcaggccgaccagatcgagaagaagtaccag
cgtggtgctctgaacaagaccgagcgcaacagcgccctggtcaagatctggtccgaggcc
accgacgaggtcggtaaggccatggaggcccacttccccgacgacaacccgatcccgatg
atcgtgaagtccggcgccgccggcaacatgactcaggttcgttcgctcgccggtatgaag
ggtctggtgaccaacccgaagggtgagttcatcccgcgtccgatcaagtcttccttcaag
gaaggcctgaccgttctcgagtacttcatcaacacgcacggtgcccgtaagggtctggcc
gataccgcgctccgcaccgccgactcgggctacctgacccgtcgtctggtggacgtctcg
caggacgtcatcgtccgcgaggtcgactgtggaaccgagcgcggcatcgtcaccacgatc
gccgagaagcaggccgacggcacgctgatccgcgacgctcacgtggagacgagcacgtac
gcccgcaccctggccgccgacgcggtcgacgagaacggcaacgtcatcgtcgagcgtgga
cacgacctgggcgacccggcaatcgacgcgctgctcgaggcaggtatcacgcaggtcaag
gtccgctcggtgctcacctgcaccaccggcaccggtgtctgcgccacctgctacggccgc
tccatggccaccggcaagctcgtcgacatcggtgaggccgtcggtatcgtcgccgcgcag
tccatcggtgagcccggtacccagctgaccatgcgtacgttccaccagggtggtgtcgcc
ggagacgacatcaccggtggtctgccgcgtgttcaggagctgttcgaggcccgcgtcccc
aagggcaaggccccgatcgccgacgtcagtggccgcgtgcagctcgaagacggcgaccgc
ttctacaagatcaccatcgtcccggacgacggtggcgaagaggttgtctacgacaagctc
tcgaagcgtcagcgtctgcgtgtcttcaagcacgacgacggcaccgaacgccttctggcc
gacggtgaccacgtcgaggtcggtcagcagctcatggaaggtgctgccgatccgcacgag
gtgctgcgtgtcatgggcccccgtcaggtgcagatccacctcgtcaacgaggtccaggag
gtgtaccggagccagggtgtgtcgatccacgacaagcacatcgaggtcatcgtgcgccag
atgctgcgtcgcgtgacgatcatcgactcgggcgccacggagttcctgcccggttcgctg
accgagcgtgcggacttcgaagcggccaaccgccgtgtcgtcgccgagggtggcgagccg
gcagccggacgtccggtgctgatgggtatcaccaaggcatcgttggcgaccgactcgtgg
ctgtccgcggcgtcgttccaggagaccactcgcgtgctgaccgatgcggcgatcaactgc
cgctcggacaagctgatcggtctgaaggaaaacgtgatcatcggaaagctgatccccgcc
ggtaccggtatcaaccgttaccgcaacatccaggttcagccgaccgaagaagctcgcgct
gctgcgtacgcggttccgtcctacgacgaccagtactacagcccggacggcttcggccag
aacaccggtgctgcggtgccgctggacgattacggtttcagcaacgattaccggtag

DBGET integrated database retrieval system