KEGG   Rhodococcus opacus PD630: Pd630_LPD06522
Entry
Pd630_LPD06522    CDS       T03071                                 

Definition
(GenBank) Alpha-ketoglutarate-dependent dioxygenase AlkB
  KO
K03919  DNA oxidative demethylase [EC:1.14.11.33]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD06522
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.33  DNA oxidative demethylase
     Pd630_LPD06522
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    Pd630_LPD06522
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2 2OG-FeII_Oxy
Other DBs
NCBI-ProteinID: AHK33708
LinkDB
Position
complement(6751900..6752523)
AA seq 207 aa
MAPGAVHVPDWLTPEEQRHLVAECRRWATAPVPMRAAQLPTGHRMSVQTVCLGWHWKPYS
YSRTAEDAGGGRVAPVPDWLVELGRRAVSDAYGQPDDGYIPDAALINFYDDTAKMGMHQD
KEERSDAAVVSLSIGDTCTFRFGNTTTRTKPYTDVELLSGDLFVFGGESRFAYHGVPKVF
PGTSDPDCGLTKGRLNITLRVTGLEDV
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgcccggcgccgtccacgtccccgactggctcacgccggaggagcagcgccacctg
gtggccgaatgccggcgctgggccaccgcaccggtcccgatgcgggccgcgcaactgccg
acggggcaccgcatgtcggtgcagacggtgtgtctcggctggcactggaagccgtattcc
tactcgcgcaccgccgaggacgcgggcggcggtcgtgtcgcgccggtgcccgactggctg
gtcgaactcggccggcgggcggtgagtgacgcgtacgggcagcccgacgacgggtacata
cccgatgccgcgctgatcaatttctacgacgacaccgcgaagatgggcatgcaccaggac
aaggaggagcggtccgatgcggccgtcgtgtcgttgagcatcggcgacacgtgcacgttc
cgcttcggcaacaccaccacccggaccaagccgtacaccgatgtcgagttgttgtcgggc
gacctcttcgtgttcggcggcgagtcccggttcgcgtatcacggagtgccgaaagtgttt
cccggcacgagcgatccggactgtggactgacgaaaggcagattgaatatcacgctgcgg
gtgacgggactcgaggacgtatga

DBGET integrated database retrieval system