KEGG   Rhodococcus opacus PD630: Pd630_LPD07472
Entry
Pd630_LPD07472    CDS       T03071                                 

Definition
(GenBank) 2,6-dihydropseudooxynicotine hydrolase
  KO
K19188  2,6-dihydroxypseudooxynicotine hydrolase [EC:3.7.1.19]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00760  Nicotinate and nicotinamide metabolism
roa01100  Metabolic pathways
roa01120  Microbial metabolism in diverse environments
Module
roa_M00810  Nicotine degradation, pyridine pathway, nicotine => 2,6-dihydroxypyridine/succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pd630_LPD07472
Enzymes [BR:roa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.19  2,6-dihydroxypseudooxynicotine hydrolase
     Pd630_LPD07472
SSDB
Motif
Pfam: DUF1100 Peptidase_S9 Abhydrolase_1 Hydrolase_4 BAAT_C DLH Esterase Peptidase_S15 Abhydrolase_6
Other DBs
NCBI-ProteinID: AHK34657
LinkDB
Position
7756988..7758085
AA seq 365 aa
MSSQPPVLTPEHEMLNWGRLILDGVPYADIVGARDRPSDQGWFEYWMSRADDYESLGDEC
VRAAHTLSAGEYFYLAAICVQYAQFLWFDDKRAHGQRRKVELYRKAAPYLKPAAELVELS
VDGTPMPMFLRVPEGTGPHPVVVLLGGLESTKEESRLMEDLLLARGMATATFDGPGQGEM
FDHRELSGDFERYTSTVIDYLVTRDDLQSDAVGVLGRSLGGNYALKSAACDQRVAACVCW
GGFADMDSWDTETPMTMESWRYVSKVKTLDEAQVHVHKALETRGVLDQLTCPTYVLHGML
DEIPSSFLETVREHAVNAPLTIVVEDEGDHCCHNLGPRPRFQMADWLADHLVTTDHSPAK
EHADG
NT seq 1098 nt   +upstreamnt  +downstreamnt
ttgtcctcgcagcctccggtactgacgccggaacacgagatgctgaactggggccgtctg
atcctggacggtgttccctatgccgacatcgtcggtgctcgcgatcgcccatcggaccag
ggttggttcgaatattggatgtcgcgggcggacgactacgagagcctcggagacgagtgc
gtacgcgcagcgcacaccctctctgcgggcgagtacttctacctcgctgccatctgcgtg
cagtatgcacaattcttgtggttcgacgacaagcgcgcacatggtcaacggcggaaagtt
gagctctacaggaaagcggcaccgtacctgaagccggcggccgagctggtcgagttgtcg
gtggacgggacgccgatgccgatgtttctccgcgtgccggaaggcaccggtccgcacccg
gtggtggtgttgctgggcggcctcgagagcaccaaggaggagagccgcttgatggaagac
ctcctgctcgcacgcggaatggcaaccgcaacgttcgatgggcccgggcaaggggaaatg
ttcgaccaccgagagctttccggtgatttcgaacgctacacctccacggtcatcgactac
ctcgtcacgcgagacgacctgcaatccgacgcggtcggtgtactcgggcgcagtttgggc
ggaaactatgctctcaagtccgctgcatgtgatcagcgtgtcgccgcatgcgtgtgctgg
ggtggtttcgcggacatggattcgtgggacaccgagactcccatgacgatggagagttgg
cgctacgtcagcaaggtgaagaccctggacgaggctcaggtgcatgttcacaaggccctg
gagactcgtggcgtcctcgaccagttgacgtgtcccacctatgtacttcacgggatgctc
gacgaaattccttcgagtttcctcgagaccgtgcgtgagcacgccgtcaatgccccgctg
acgatcgtggtcgaggacgaaggtgaccactgctgtcacaatctcggtccgcgcccccgg
ttccagatggccgactggcttgcagatcatctggtcacgactgaccattcgccggcaaag
gagcacgcagatgggtga

DBGET integrated database retrieval system