KEGG   Rhodococcus opacus PD630: Pd630_LPD07530Help
Entry
Pd630_LPD07530    CDS       T03071                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pd630_LPD07530
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Pd630_LPD07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO K_oxygenase FAD_binding_3 Glutaredoxin FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHK34715
LinkDB All DBs
Position
7821701..7823293
Genome map
AA seq 530 aa AA seqDB search
MLEASLAGQLKSLLEKLTLPIELVSSLDDGPKSVELAELLTQIAAMSEKITYERRDDDTR
RPSFAVRRSGTDIEVRFAGIPLGHEFTSLALALLQVGGHPSKEAPELLEQVRDLDGDFHF
ETYFSLSCQNCPDVVQALNLMCVLNPRISHVAIDGALFQDEVDGRQIMAVPTVFLNGELF
GSGRMSLEEIAGKLDVGAADRAAAAIAQKDPFDVLVVGGGPSGAAAAVYAARKGIRTGIA
AERFGGQVLDTMAIENFISVPYTEGPQFGSALENHVRQYGVDIMNTQRAAKLVPAATENG
LVEIELESGASLLARTVILSTGARWRSMNVPGEDTYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVEHVTLVEFDSVLRADDVLQRKLRSLPNADILLSTLTTEVLGDG
NKVTGLTYQDRTTDTSHTLDIEGVFVQIGLLPNTEWLAGSVELSDRGEIAIDDRGQTSVP
GVFAAGDCTTVPYKQIVIAAGAGATAALSAFDRLIRTGVPAEDSTAATVG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagcctcgcttgccggccaactgaagtccctgctcgaaaagctgaccctgccg
atcgagctcgtgtcctcactcgacgacggacccaagtcggtcgaactcgccgaactgctc
acccagatcgcggcgatgtcagaaaagatcacctacgaacgccgcgacgacgacacgaga
cgcccgtcgttcgcggtccgccgcagcggcaccgacatcgaggtccgcttcgccggcatc
ccgctcggccacgagttcacctcgctcgcactcgctttgctccaggtcggcggccacccg
tcgaaggaggcccccgaactgctcgagcaggtccgtgacctcgacggcgacttccacttc
gagacctacttctcgctgtcctgccagaactgccccgacgtggtgcaggccctgaatctg
atgtgcgtgctcaatccgcgcatcagccacgtcgcgatcgacggcgccctgttccaggac
gaggtcgacggccgccagatcatggcagtcccgacggtcttcctcaacggcgaactcttc
ggctccggccggatgagcctggaggaaatcgccggcaagctcgacgtcggcgccgcagac
cgagccgccgccgcgatcgcgcagaaggatcccttcgacgtgctcgtcgtcggaggtggc
ccgtccggtgccgcggccgcggtatatgccgcgcgcaagggaattcgcaccggaatcgcc
gctgaacgcttcggcggtcaggtgctcgacaccatggcgatcgagaacttcatctccgtc
ccttacaccgagggaccccagttcgggtcggcgctcgagaatcacgtccgtcagtacggc
gtcgacatcatgaacacgcagcgtgccgcgaagctcgtgccggccgccaccgagaacggt
ctcgtcgagatcgaactggaaagcggtgcttctcttctcgcgcgcaccgtgatcctgtcg
acgggtgcgcggtggcgttcgatgaacgtgcccggcgaggacacgtaccggaacaagggt
gtgacctactgcccgcactgcgacggaccgctgttcaagggcaagcgcgtcgccgtgatc
ggtggcggtaactccggcgtcgaggccgcaatcgacctcgcgggaatcgtcgagcacgtc
acgctcgtcgagttcgactcggtgctccgcgccgacgacgtgttgcagcgcaagctgcgc
agcctcccgaacgcggacatcctcctgagcacgctcacgacggaggtcctcggggacggt
aacaaggtcaccggcctgacctaccaggaccgcacgaccgatacctcgcacacgctcgac
atcgagggtgtcttcgtccagatcggcctcctgcccaacaccgagtggctggccgggtcc
gtcgagttgtccgatcgcggcgagatcgcgatcgacgaccgcggccagacgtcggtgccc
ggcgtgttcgctgccggcgactgcacgaccgtgccgtacaagcagatcgtgatcgccgcc
ggtgccggagcaacggcagcgctgagcgcgttcgatcggctcatccggacgggcgtaccc
gccgaggattccaccgccgcaacggtcggatag

DBGET integrated database retrieval system