KEGG   Rhodococcus opacus PD630: Pd630_LPD07669
Entry
Pd630_LPD07669    CDS       T03071                                 

Definition
(GenBank) putative mutator mutT1 protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD07669
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     Pd630_LPD07669
DNA repair and recombination proteins [BR:roa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Pd630_LPD07669
 Prokaryotic type
    Pd630_LPD07669
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: AHK34854
LinkDB
Position
complement(7960701..7961168)
AA seq 155 aa
MFVLVRHSHAGDKKQWHGPDVERPLSPLGHEQAHGLVAALSGIEIETLLSSPTTRCRQTL
LPLAQARGLPIHDEPLLAPDAPPDELFAALHRPDADRAVFCTHGEILNALAEFAQARGIP
GLPPSGATAKGGVWFVDCGAGPPPALRYLAPIPTR
NT seq 468 nt   +upstreamnt  +downstreamnt
atgttcgtcctggtccggcattcccatgcgggcgacaagaagcaatggcacggccccgac
gtcgagcgtccgctgagcccgctcgggcacgagcaggcccacggcctcgtcgcggcgctg
agcggcatcgagatcgagacactgctctccagtcccaccacccgttgtcgccagaccctg
ctgccgctcgcgcaggcgcgcggtctgcccatccacgacgaaccgctgctggcacccgac
gcaccccccgacgaactgttcgccgctctacacagacccgacgccgaccgggcggttttc
tgcacccacggggagatcctcaacgcgctggccgagttcgcgcaggcgcgcggaataccg
ggcctccctccctcgggggcgaccgcgaaagggggcgtgtggtttgtcgactgcggtgca
ggtccgcctccggcgctgcggtacctcgcgccgattccgacccgctga

DBGET integrated database retrieval system