KEGG   Blautia obeum: CK5_15210Help
Entry
CK5_15210         CDS       T02605                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rob  Blautia obeum
Pathway
rob00473  D-Alanine metabolism
rob00550  Peptidoglycan biosynthesis
rob01100  Metabolic pathways
rob01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rob00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK5_15210
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CK5_15210
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CK5_15210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rob01011]
    CK5_15210
Enzymes [BR:rob01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CK5_15210
Peptidoglycan biosynthesis and degradation proteins [BR:rob01011]
 Precursor biosynthesis
  Amino acid ligase
   CK5_15210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 GARS_A RimK ATP-grasp ATP-grasp_4 ATPgrasp_YheCD ATPgrasp_ST ATPgrasp_Ter GSP_synth
Motif
Other DBs
NCBI-ProteinID: CBL22943
UniProt: D4LQ85
LinkDB All DBs
Position
1504816..1505850
Genome map
AA seq 344 aa AA seqDB search
MKIVVLAGGTSTERDVSIVSGTGICSALRQKNHQAILVDVFCGLENVDWADPFPESYDVE
QAVSYIKSFNPHIEELKKSRKEFFGPNVLELCKKADFVFLGLHGSNGEDGRLQAVFDLMG
ILYTGTGYLSSAMAMDKGVTKAMFQMRGVPTPGGKAMKKKDRVETLQELGMDFPVVVKTC
CGGSSIGVYIVDNQADYTKALDGAFTYENEVVVEEFVEGTEYTVAVVDGKAYPVVQIVPV
QGFYDYENKYKPGAVKETCPAPISEELTRRLQEYAVEGYHALEMESYGRLDFIVTKDEKI
YCLEANTLPGMTPTSLIPQEAAVLGMDYPTLCEELIRVSMKKYE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttgtattagcagggggaacaagtacagaaagggatgtttcaatcgtatcc
ggcacaggaatctgcagtgcgctgcgtcagaaaaatcatcaggcaattctcgtcgatgtt
ttttgcggactggagaatgtagactgggcagatccttttccggaaagctatgatgtagag
caggcagtttcctacatcaagagttttaacccgcatatcgaagagttaaaaaagagcagg
aaagaatttttcggaccgaatgttctggaactttgtaagaaagcggattttgttttcctc
ggactgcatggatccaacggcgaggacggaagactgcaggctgtatttgacctgatggga
attctgtataccggaacaggctatctcagcagtgcgatggcgatggacaaaggtgttaca
aaagccatgttccagatgcgcggtgtaccgacaccgggcggcaaagccatgaagaaaaaa
gaccgcgtggagacactgcaggagcttggcatggatttccctgttgtagtcaagacatgc
tgtggaggttccagcattggtgtttatattgtagataatcaggctgattatacaaaagct
ctggatggagcatttacctatgaaaatgaagttgtcgtagaagaatttgtcgagggtact
gagtatacggttgcggtggtggacggtaaagcatatccggttgtacagatcgttccggtt
cagggattctatgactatgagaataaatacaaaccgggcgcagtgaaagaaacctgtccg
gcaccgatttccgaagaactgaccagacgtcttcaggaatatgcggtagaaggctatcac
gcacttgaaatggaaagttatggccgtcttgatttcatcgtaacaaaagatgaaaaaatc
tactgtctcgaggcaaacactcttccgggaatgacacctaccagtctgatcccgcaggag
gcagcagtacttggtatggactatccaacgctgtgcgaagaactgatcagagtttcaatg
aaaaagtacgaatga

DBGET integrated database retrieval system