KEGG   Blautia obeum: CK5_17430Help
Entry
CK5_17430         CDS       T02605                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rob  Blautia obeum
Brite
KEGG Orthology (KO) [BR:rob00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rob01001]
    CK5_17430
Enzymes [BR:rob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CK5_17430
Protein kinases [BR:rob01001]
 Serine/threonine kinases: Other
  Bacterial family
   CK5_17430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo PBP1_TM Haspin_kinase WaaY ABC1 RIO1 UCR_TM Velvet
Motif
Other DBs
NCBI-ProteinID: CBL23145
UniProt: D4LQT7
LinkDB All DBs
Position
1764616..1766832
Genome map
AA seq 738 aa AA seqDB search
MLKTGMIIAERYEILGKIGTGGMADVYKAKDHKLNRFVAVKVLKPEFREDTTFIRKFRSE
AQAAAGLTHPNIVNVFDVGDDEGVYYIVMELIEGITLKEYIAKKGKLSIKEATSIAIQVS
MGLEAAHNHGIVHRDVKPQNIIISTDGKVKVTDFGIARAASSNTISSNVMGSVHYSSPEQ
VRGGYSDEKSDIYSLGITLYEMVTGRVPFDGDTTVAIAIKHLQEEMVPPSVYAEDLPYSL
EQIILKCTQKSVNRRYDKMEDVIADLKHSLIEPQGDFVKLSSVDNEAKTVVISDEELGEI
KHSPKKRTSDIAQLEDEEYDTDYEDYEDDHRRKRSSDKKSRKKHKAPNRGLTILALLAGA
AILVAAIFFIGKAAGIIGGDSSTDTSQNDQNTDASTDEDGMVIVPNLVGKTEAEATALLE
EEKLGKQMMGEESSTQEKGRISSQNIAAGTKVEQYTTLKYYISKGQQAVTMPDLSGETGV
DAQQTLEDLGLTVNVQKAYSEDDGSGYPLVNPGYVDSYTPEAGSSVSAGDEVTLVVSRGL
DYGNSVSVPSVVGMTENDAITTLGKWIDVQVTEQQSTDVAAGEVISQSPEADTAADPDQP
ITIVVSSGNEAPGAQKDNTASTAATDTQTTDAASAQSAADTSAQQSAAAANGEVWKCTQS
LNTPNGYQGGAIRLELIQEVNGEMTSTQVVDGKKLTFPYTLDITGAPGVSAGTLYVSEQI
NGTYQQLGQYPISFQKAE
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacaggaatgatcatagcagagcgctatgaaatcttagggaagatcggcacc
ggtggaatggccgatgtatataaggcaaaagatcataagctgaaccgttttgtagcggtc
aaggtgttaaaaccggaatttcgggaggatactacattcatccgtaaattccgcagcgag
gcacaggcagctgcgggactgacacatccgaatattgtcaatgtatttgatgtaggggat
gacgaaggtgtttattacattgtaatggaactgatcgaaggcatcacgctgaaagaatac
attgcaaagaaaggcaaactttctattaaagaggcgaccagcattgccattcaggtatca
atgggactggaagccgcacataatcacggaatcgtacaccgcgatgtaaaaccgcagaat
atcattatttcaacagacggcaaggtcaaggttactgatttcggaatcgcaagagcggca
tcttccaataccatcagttctaatgttatgggatctgtacattacagctcaccggagcag
gtacgtggaggatacagcgacgaaaaaagtgatatttattcacttggtattactttatat
gagatggttaccggacgtgttccgtttgacggagatacgactgtggcaatcgctatcaaa
catcttcaggaagaaatggttccgccgagtgtttatgcggaagatctgccatacagcctt
gagcagatcattctgaaatgtacgcagaagagtgtaaatcgccgttacgacaaaatggaa
gatgtgattgcagacctgaaacattctctgatcgaaccacagggggattttgttaaattg
tcctctgttgataatgaggcaaagacagttgtgatctctgacgaagaactcggagaaatc
aaacacagtccgaagaaacgtacatcagacattgcgcagcttgaagacgaggaatacgat
acggattatgaagattatgaagatgatcatcgccgtaaacgttcctctgataaaaaatcc
aggaagaaacataaagcaccgaataggggccttacgattcttgcacttcttgcaggtgcg
gctattttggttgcggcaatcttctttatcggaaaagcagccggcatcataggcggtgac
agtagtacagatacttcacagaacgatcagaacacagatgcatcgacagatgaggatgga
atggtaattgttccgaatctggtaggaaagacggaagcagaagctactgcacttcttgaa
gaagaaaaactcggcaagcagatgatgggcgaagaaagttccacacaggaaaaaggacgc
atttcttctcagaatattgcggcaggaacaaaagttgaacagtatacaactctgaaatat
tacatcagtaagggacagcaggctgtaacgatgcctgatctctccggagagaccggagtg
gatgcgcagcagacactggaagatctcggacttacggtgaatgttcagaaagcatacagt
gaagatgacggaagcggttatccgctggtaaatccgggatatgtagattcttatacaccg
gaagcaggaagcagtgtaagtgcgggtgatgaagtaactctggttgtcagccgtggtctt
gattatggcaacagtgtatcagtgccgagtgtagtcggtatgacagaaaatgatgcgatc
accacacttggcaaatggatcgatgttcaggtgacagagcagcagagcacagatgtggca
gcaggagaagttatttctcagagtccggaagcagatacagcagctgatccggatcagccg
atcacgatcgtagtcagcagcggcaatgaagcaccgggtgcacagaaagataacacagct
tccaccgcagcgacagatacacagacaacagatgcagcatctgcacagtccgcagcagat
acaagtgcacagcagagtgcagctgcggcaaacggcgaagtatggaaatgcacacagtct
ttaaatacaccgaacggttatcagggcggagcaattcgtctggagctgatccaggaagta
aatggagagatgacatctacacaggttgtggacggaaagaaacttactttcccatataca
ctggatatcaccggtgcaccgggagtcagcgccggtacattatatgtttctgagcagata
aatggtacttaccagcagcttgggcagtacccgatctcattccagaaagccgagtaa

DBGET integrated database retrieval system