KEGG   Blautia obeum: CK5_18610Help
Entry
CK5_18610         CDS       T02605                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenases
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rob  Blautia obeum
Pathway
rob00040  Pentose and glucuronate interconversions
rob00051  Fructose and mannose metabolism
rob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CK5_18610
   00051 Fructose and mannose metabolism
    CK5_18610
Enzymes [BR:rob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CK5_18610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C HycI Methyltransf_25 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBL23252
UniProt: D4LR44
LinkDB All DBs
Position
1889315..1890367
Genome map
AA seq 350 aa AA seqDB search
MKAAVVVANEDVQYQEIEEPKVTKGAVKIKVRYSGICGSDIPRVLNHGVHFYPIVLGHEF
SGDVVEVGEGVTKVKVGDRVSGAPLLPCMKCDDCQQGNFSLCKHYSFIGSRQQGSNADYV
VVPEQNAVPFDKSVSYEQGAMFEPATVAIHGVFQNDYHGGEYVAILGGGTVGMFTMQWTK
IFGSKKVVVFDISDERLELAKRLGADEVINTKEEGYMEKAMAITGGKGYGFVFETAGQVP
TMHMAFELAANKAHVCFIGTPHENLTFTPAQWENMNRKEFKLTGSWMSYSAPYPGREWDL
TAHYFATGQLKFDPGFVYKKIPMSQAQEAFQLFKTPGLVKGKILLSNEED
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtagtagttgcaaatgaagatgtacagtatcaggaaattgaagaacca
aaggtaacaaaaggtgccgtaaagatcaaagtcagatattccggtatctgtggatccgat
atcccgcgtgttctgaaccatggtgttcatttttacccgatcgttctcggccatgaattt
tccggtgatgtagtagaagtcggcgaaggtgtaacaaaggtaaaagtcggcgaccgtgta
tccggtgcaccgcttctcccatgtatgaaatgtgacgactgccagcagggtaacttctcc
ctttgcaaacattacagctttatcggttccagacagcaaggaagcaatgcagattatgtt
gtagttccggagcagaatgcagttccttttgacaagagcgtatcctatgagcagggcgca
atgtttgagcctgcaactgtggctatccatggtgtattccagaacgattatcacggcgga
gaatatgttgcgatcctcggcggtggtacagtcggaatgttcaccatgcagtggacaaag
atcttcggatcaaagaaagttgttgtattcgatatcagcgatgagcgtcttgagcttgca
aaacgtcttggtgcagatgaagtcatcaatacaaaagaagaaggttacatggaaaaagca
atggcgatcaccggcggcaaaggatacggatttgtatttgagacagccggacaggttccg
accatgcatatggcatttgaacttgctgcaaacaaagctcatgtatgttttattggtact
ccacatgagaacctgaccttcacacctgcgcagtgggaaaacatgaaccgcaaagagttc
aaactgaccggttcctggatgtcttacagtgcaccatacccgggacgtgaatgggatctg
acagcgcattattttgcaactggccagctgaaatttgatccgggcttcgtttacaaaaag
attccgatgagtcaggcacaggaagcattccagttatttaagacaccgggacttgtaaaa
ggaaagattctcttatcaaacgaggaagattga

DBGET integrated database retrieval system