KEGG   Roseovarius sp. THAF27: FIU89_09570
Entry
FIU89_09570       CDS       T06352                                 

Gene name
ykoV
Definition
(GenBank) putative DNA repair protein YkoV
  KO
K10979  DNA end-binding protein Ku
Organism
roh  Roseovarius sp. THAF27
Pathway
roh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:roh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    FIU89_09570 (ykoV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roh03400]
    FIU89_09570 (ykoV)
DNA repair and recombination proteins [BR:roh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FIU89_09570 (ykoV)
SSDB
Motif
Pfam: Ku
Other DBs
NCBI-ProteinID: QFT80855
UniProt: A0A5P9H1J0
LinkDB
Position
1914835..1915662
AA seq 275 aa
MASRALWTGQLRLSLVSIPVEIHSARNSSSRVSFRQIHKPSGKPVRYQKTVQGVGPVEND
DIMKGYETDDGDYILLEPDEIDAIKLETKKTLELVQFVETSEIAPIWFDRPYYVVPSDEL
AEDAYRVVRDALRQTKKAGLGQLTMRGKEYLCAIRPCGDGLLMETLHYEADIRDADPLFS
GIEDDASDEELLEVATQLIDKKTAPFDASAFEDHYAAALKDLIAAKMKSKKTPRAKAADD
GGVAEAENVVDLMDALKKSLKQSKGGKSTRRKKAS
NT seq 828 nt   +upstreamnt  +downstreamnt
atggcatcacgcgctctctggacaggacagcttcgcctgtcgctggtgtccattccggtg
gaaatccattccgcccgcaattcctcttcgcgcgtgtcgttccgccagatccacaagccc
tcgggcaagcccgtgcgctatcagaagacggttcagggggtcggccccgtcgagaacgat
gacatcatgaagggctatgagaccgacgatggggactatatcctgctcgagccggacgag
atcgacgcgatcaagctggaaacgaagaagacgctggagctggtgcagttcgtcgagacc
tcggaaatcgcgcccatctggttcgaccggccctattacgtcgttccctccgacgagctt
gcggaggatgcctatcgcgtggttcgcgatgccttgcggcagacaaagaaggcgggtctc
ggtcagctgaccatgcgcggcaaggaatacctgtgcgccatccgcccctgcggcgacggg
ctgttgatggagacgctgcattacgaggcggacatccgcgacgccgacccgctgttttcc
gggatcgaggacgacgcctcggacgaggaactgctcgaggtcgccacccagctgatcgac
aagaaaaccgcgcccttcgatgcctcggccttcgaggatcactacgcggcggccctgaag
gacctgatcgctgccaagatgaaatcgaagaagacgccccgcgccaaggccgccgatgac
ggtggcgttgccgaggcggaaaacgtggtcgacctgatggatgcgctgaagaagagcctg
aagcagagcaagggcggcaagtccacccgccgcaagaaggcctcgtga

DBGET integrated database retrieval system