KEGG   Roseovarius sp. THAF27: FIU89_09575
Entry
FIU89_09575       CDS       T06352                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
roh  Roseovarius sp. THAF27
Pathway
roh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:roh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    FIU89_09575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roh03400]
    FIU89_09575
Enzymes [BR:roh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FIU89_09575
DNA repair and recombination proteins [BR:roh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FIU89_09575
SSDB
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Other DBs
NCBI-ProteinID: QFT80856
UniProt: A0A5P9GYF9
LinkDB
Position
1915659..1918103
AA seq 814 aa
MRSLDAYREKRDFDVTPEPRAELVDAGGERLSFVVQKHDASRLHYDFRLELGGVLLSWAV
TKGPSTDPSQKRLAVRTEDHPVSYGGFEGTIPKEEYGGGTVMLWDNGWWEPLHDPEEGLK
EGKLHFRLHGARMKGGWALVRMRAKKGEKRENWLLIKERDDFAGRTAEALTNKHRTSVTT
GRAMRAIAGDKPAATPAKHDKPLPRFHKVQLATLRDAPPEGEGWQHEAKFDGYRCVIALG
KGGVRLYSRNGKDWSDRFGALCEPAAALACGSALIDGEVITGAGGGDFSTLQKALKAGDP
LTCYLFDILVLDGEDLTGKPLSQRREALEGLMDGQPPRGPLRLSPVIEGDGAAALAAICE
AGGEGLVSKRIDAAYRAGRSKSWIKSKCIRRAEFVVAGWSPSDKKGRPFSSLILGSFEAG
TLIYRGRVGTGFDGDDMAELMAALKPLARKTPPFDEDLPDETTGARWVTPRLVVEADYAE
FTSEGRIRHGVYKGLREDKEARDVSASAEAKNDSGDDEKTIGGVRISSTSRRVYPDAGLT
KGEVAEHYAQVAERMLDDAADRPLALLRCPDGIAGDCFFQKHAGKGFPEGVKSIPIEEKD
GDRADYMYVSGPEGLLGAAQMGTLEFHIWGARRDRIERPDRMVFDLDPDEGLGFARVKAA
AQEVREGLSACGLDSAPMVTGGKGVHVIVPLRRISEWETVKTFAKTFATVLAERHPKRYT
ATMSKSKRKGRVFIDWLRNERGATAIAPYSLRARPGAAVAVPVTWAELQDLSCPDGFHVG
DMAARLKRPCPLRTAKARGIGAEVVEALEDWSRD
NT seq 2445 nt   +upstreamnt  +downstreamnt
gtgaggtccctggacgcatatcgcgagaagcgggatttcgacgtcacgccggagccccgc
gccgagcttgtcgacgccggcggcgagcgcctgtccttcgttgtccagaaacatgatgcc
agccgcctgcactatgactttcgcctggaactgggcggtgtgctgctgtcctgggccgtc
accaagggcccctcgaccgatccgtcgcagaagcgcctcgctgtgcgcaccgaggatcac
ccggtgtcctatggcggtttcgagggcaccatcccgaaagaggaatacggcggcggcacc
gtcatgctgtgggacaacggctggtgggagccgctgcacgatcccgaggagggtctgaag
gagggcaagctgcatttcaggctgcacggcgcgcggatgaaaggcggctgggcgctggtg
cggatgcgcgccaagaagggcgagaaacgcgagaactggcttctgatcaaggaacgcgac
gattttgccgggcgcaccgccgaggcgctgaccaacaagcaccgaacgtccgtgaccacc
ggccgtgcgatgcgcgcgattgccggggacaaacccgccgccacgcctgcgaaacacgac
aagccgctgccccggtttcacaaggtgcagctggccaccctgcgcgatgccccgcccgag
ggcgagggctggcagcacgaggccaagttcgacggctatcgctgcgtgatcgccctgggc
aagggtggggtgcggctctactcgcgcaacggcaaggactggtccgaccgtttcggggcg
ctctgcgaaccggcggcggcgttggcctgtggctcggccctgatcgacggggaagtgatc
accggcgccgggggaggggacttctcgacgctccagaaagcactgaaggcgggtgacccg
ctcacctgctaccttttcgacatccttgtcctcgatggcgaggatctgaccggcaagccg
ctctcgcagcggcgcgaggcgctggaagggctcatggacgggcagccgccccgcgggccg
ctccgcctcagcccggtgatcgagggcgatggcgccgccgcccttgccgccatctgcgag
gccggcggggagggcctcgtctccaagcgcatcgatgccgcctatcgcgccggtcggagc
aaaagctggatcaagtccaagtgcatccgccgggccgagttcgtggtcgccggatggtcg
ccctcggacaagaagggcaggccgttttcctcgctgatcctggggagctttgaggcgggc
acgctgatctaccggggtcgcgtcggcacggggttcgacggagacgacatggcggaactg
atggccgcgctgaagccccttgcccgcaagacccccccgtttgacgaagacctgcccgac
gagacaaccggcgctcgctgggtcacgccaaggctggtcgtcgaggcggactatgccgag
ttcaccagcgaaggccggatacgccacggcgtctacaagggcctgcgcgaagacaaggag
gccagggacgtgagtgccagcgccgaagcgaagaacgacagcggcgacgacgagaaaacc
atcggcggcgtccgaatctccagcacctcgcgccgggtctatcccgatgcgggtctgacc
aagggcgaggttgcggaacactacgcgcaggtcgccgaacggatgctcgatgacgccgcc
gaccgccccctggcactgttgcgctgccccgatgggatcgcgggcgattgcttctttcag
aaacacgccggcaagggctttcccgagggcgtcaaatccattcccatcgaggaaaaggac
ggcgacagggccgattacatgtatgtctccggccccgagggcctgcttggcgcggcgcag
atgggcacgctggaattccacatctggggcgcgcggcgcgaccggatcgaacggcccgac
cggatggtgttcgatctggatcccgatgagggcctcggctttgccagggtgaaggcggcg
gcgcaggaggtccgcgagggcctgagcgcctgcgggctggacagcgcgcccatggtcacg
ggcggcaagggtgtgcacgtgatcgtgccgctgcgccgcatcagcgagtgggagacggtg
aaaaccttcgccaagacctttgctacagtcctcgcggagcgccacccgaagcggtacacc
gccaccatgtccaagtccaaacgcaaggggcgcgtgttcatcgactggctgcgcaacgag
cgcggcgccaccgccattgcgccctattccctccgcgcgcgccccggcgccgcggtcgcg
gtgcctgtgacctgggccgagttgcaggacctgagctgtcccgacggctttcatgtgggc
gatatggcggcacgtctgaaacgcccatgcccgctgcggacggccaaggcgcgcggcatc
ggagccgaggtcgtggaagcgctggaagactggtctcgcgactga

DBGET integrated database retrieval system