KEGG   Roseovarius sp. AK1035: RAK1035_2332Help
Entry
RAK1035_2332      CDS       T05517                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00010  Glycolysis / Gluconeogenesis
rok00020  Citrate cycle (TCA cycle)
rok00620  Pyruvate metabolism
rok01100  Metabolic pathways
rok01110  Biosynthesis of secondary metabolites
rok01120  Microbial metabolism in diverse environments
rok01130  Biosynthesis of antibiotics
rok01200  Carbon metabolism
Module
rok_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAK1035_2332
   00020 Citrate cycle (TCA cycle)
    RAK1035_2332
   00620 Pyruvate metabolism
    RAK1035_2332
Enzymes [BR:rok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RAK1035_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AWZ21040
LinkDB All DBs
Position
2397258..2398565
Genome map
AA seq 435 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDTVSAGDLLAEIETDKATMEFEAVEEGVVGKIL
VAEGTEGVKVNTPIAVMLDEGESAADISSAPAKAEAPAAKQAEATPQAEVAAKPAPAAPK
TGDGDRIFASPLARRIAADKGIDLAGITGSGPHGRIVKADVEGAKAGAAPVASAAEAPAS
KAATPAPAAAPSGPSSDAVVAMYQGRAYEEVKLDGMRKTIAARLTEAKQTVPHFYLRREI
RLDALMKFRAELNKQLEPRGVKLSVNDFIIKACALALQAVPDANAVWAGDKVLRLKPSDV
AVAVAIEGGLFTPVLKDAEMKSLSALSAEMKDLAKRARDRKLAPQEYQGGTFAISNLGMF
GIENFDAVINPPHGAILAVGAGLKKPVVGKDGELTVATVMSVTLSVDHRVIDGALGAELL
TKIVENLENPMVMLA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattctgatgcccgccctctcgcccacgatggaagagggcacgctggcc
aaatggctggtcaaagagggggataccgtttctgcgggcgatctcttggccgagattgag
actgacaaggccacgatggaattcgaggcagtggaagagggcgttgttggcaagatcctg
gtggccgaaggcaccgaaggggtcaaggtcaacacccccatcgcggtgatgctggatgag
ggcgaaagcgctgcggatatatccagcgccccggccaaggccgaggctccggcagccaaa
caggccgaggccacgccgcaagccgaagttgcggccaaacctgcccccgccgcgccgaaa
acgggcgatggggatcgcattttcgcctcgccgcttgcgcgtcgcatcgcggcagacaag
gggattgatctggcaggcatcaccggttcgggcccgcatggccggattgtcaaggcggat
gtggaaggggccaaggctggcgctgcccccgttgcaagcgctgccgaggctccggcaagc
aaggctgcaaccccggcacccgctgcagccccttctggtccgtcgtcggatgccgtggtt
gccatgtatcagggccgcgcctatgaagaggtcaagctcgacggcatgcgcaagaccatt
gctgcgcgcctgaccgaggccaagcaaaccgtgccgcatttctacctgcggcgtgaaatc
cgccttgatgcactgatgaaattccgcgcggagctgaacaaacagttagagccacggggc
gtcaagctgtcggtcaatgactttatcatcaaagcctgtgcgcttgcccttcaggcggtg
ccggatgccaatgccgtctgggccggtgacaaggtgctgcgcctgaaaccctctgacgtg
gcggtggcggtggccattgaaggtgggctctttacgccggttctaaaggacgccgagatg
aaatctctttcggcgctatcggcagagatgaaagacctcgccaaacgcgcccgtgaccgc
aagttggcaccacaggaatatcagggcggcacctttgcgatttccaaccttggcatgttc
ggaatcgagaatttcgatgccgtcatcaacccgccgcatggtgcgatccttgccgttggc
gcagggctgaaaaagccggtggtgggcaaggatggcgaattgaccgtggccacggtcatg
tcggtgacgctctcggtggatcaccgggtgatcgacggcgcacttggtgcggagcttttg
acgaaaatcgtcgagaaccttgaaaatccgatggtcatgttggcctaa

DBGET integrated database retrieval system