KEGG   Roseovarius sp. AK1035: RAK1035_2983Help
Entry
RAK1035_2983      CDS       T05517                                 

Definition
(GenBank) 2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase II
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rok01100  Metabolic pathways
rok01110  Biosynthesis of secondary metabolites
rok01130  Biosynthesis of antibiotics
rok01230  Biosynthesis of amino acids
rok02024  Quorum sensing
Module
rok_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RAK1035_2983
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RAK1035_2983
Enzymes [BR:rok01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     RAK1035_2983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AWZ21691
LinkDB All DBs
Position
3083169..3084539
Genome map
AA seq 456 aa AA seqDB search
MTEWQKTGWRAKPRVQMPDYLDAAALANVEARLRQYPPLVFAGEARRLKRALGAAARGEA
FLLQGGDCAEAFDQFSADAIRDTFKVMLQMAMVLTYGAKVPVVKVGRMAGQFAKPRSAPT
EVIEGVELPSYRGDIINELAFTPEARIPNPDKMLQAYTQAAATLNLLRAFSTGGYADVHQ
VHAWTLGFTESEKAAKYREMANHISDALDFMKAAGVDSDNAHTLKTVDFYTSHESLLLEY
EEALCRLDSTSGKWLAGSGHMLWIGDRTRQPDGAHVEFLRGVQNPIGLKCGPSMTSDDLK
RLLATLNPSNEAGRLTLIARFGAGKVAENLPRLIRTVQEEGASVLWVCDPMHGNTIKSAT
GYKTRPFELVLREVQEFFGIHKAEGTIPGGVHFEMTGQDVTECTGGMRALSEENLSARYH
TACDPRLNASQSLELAFLVAEELKSLRHDRRQAEAG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatggcagaaaacgggctggcgcgcgaaaccgcgggtgcagatgcctgattat
ctcgatgccgccgcactggccaatgtcgaggcccgtctcaggcagtatccgccgctggtt
ttcgccggtgaggcgcgccggctcaaacgtgcgctcggcgctgctgcgcgcggcgaagcg
ttcttgcttcagggcggcgattgcgccgaggcctttgatcaattctcggctgatgcgatc
cgcgacaccttcaaggtgatgctgcaaatggcgatggtgctgacctatggggcgaaggtg
ccagtggtcaaggttggccgcatggcggggcaattcgccaagccgcgctcggccccgacc
gaggtgatcgagggcgtggaattgcccagctaccggggcgatatcatcaacgaactggcc
ttcacccccgaggcgcgcattcccaatccggacaagatgttgcaggcctatacgcaggct
gcggccacgctgaacctgttgcgtgctttttcaaccggcggctatgccgatgtgcatcag
gtccatgcctggacgctgggctttaccgaaagcgagaaagccgcgaaataccgcgaaatg
gccaatcacatctcggacgcgctcgactttatgaaagcggcgggtgtggacagcgacaat
gcccatacgctcaagaccgtggatttctacacctcgcatgaaagcctcttgctggaatat
gaagaggcgctgtgccggctcgactccacctctgggaaatggctggcgggctctggccac
atgctgtggatcggcgaccgcacccggcagccggatggcgcgcatgtcgaatttctgcgt
ggcgtgcagaatcccattggccttaaatgcggcccgtcgatgacctcggacgatctcaag
cggctcttggccacgctcaaccccagcaatgaggccgggcgtctgacactgatcgcgcgc
tttggtgcgggcaaggtggcggaaaacctgccgcgcctgatccgcacggtgcaggaagag
ggggcatcggtgctctgggtctgtgatccgatgcatggcaatacgatcaaatccgcgacc
ggctataaaacccggccgtttgaattggtcctgcgcgaggttcaggaattctttggcatc
cacaaggccgagggcaccatccccggcggcgtgcatttcgagatgaccgggcaggatgtg
accgaatgcaccggaggcatgcgggcgctctccgaagaaaacctgtcggcgcgctatcac
accgcctgcgatccgcgcctcaatgccagccaatcgctcgaactggccttcctcgtggcg
gaagaactgaaatccctgcgccatgatcgccgtcaggccgaagcaggataa

DBGET integrated database retrieval system