KEGG   Roseovarius sp. AK1035: RAK1035_4104Help
Entry
RAK1035_4104      CDS       T05517                                 

Definition
(GenBank) Enoyl-acyl-carrier-protein reductase, NADH
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00061  Fatty acid biosynthesis
rok00780  Biotin metabolism
rok01100  Metabolic pathways
rok01130  Biosynthesis of antibiotics
rok01212  Fatty acid metabolism
Module
rok_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RAK1035_4104
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RAK1035_4104
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RAK1035_4104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rok01004]
    RAK1035_4104
Enzymes [BR:rok01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RAK1035_4104
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RAK1035_4104
Lipid biosynthesis proteins [BR:rok01004]
 Fatty acid synthase
  Component type
   RAK1035_4104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AWZ22759
LinkDB All DBs
Position
unnamed:complement(130679..131521)
Genome map
AA seq 280 aa AA seqDB search
MPEFDACCDPAELLDLSGRKGLVVGIANDRSLAWPAALHFRQAGAELAITYVDERTKPHV
VPLAARLEAPILLPCDVNAPHELDAVFDAITDRWGKLDFILHAVGSVPPGDLHGRLTDCS
AAGFSQAMHVSVHSLIRMAHLAEPLMKSGGSLITLSYLGGERVVENYNVMGPVKAALEAT
VRYLAHELGPSNIRVNAISAGPVMTRAASGLTGFAGLLDATARVAPLRRNVTADEVGRAA
LLFASDYTGGITGEVLHVDAGVHVESPVAAAKMNVKSEES
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattcgacgcatgctgcgatcctgcggaactgcttgatctgtccggccggaag
ggtctggttgtcggcatcgccaatgatcgcagtctggcgtggcctgctgccctgcatttc
cgtcaagcgggtgccgagctcgccatcacctatgtcgatgagcgcaccaaacctcatgtg
gtgccattagctgcacgtctcgaagcgccgatcctgctgccctgtgacgtgaatgcgccg
cacgaactcgacgctgtcttcgacgccatcacggaccgctggggaaaattggatttcatc
cttcatgccgtgggcagcgtgccgcccggcgaccttcatggccgcctgactgactgttcg
gctgcagggttttcccaagcgatgcatgtgtccgtccattcgctgatccgcatggcgcat
cttgccgagcccctgatgaaaagcggcggcagcctgatcactctgagctatctgggtggc
gaacgtgtggtggagaattacaacgtgatggggccggtcaaggcggcgcttgaggccacc
gtgcgctatctggctcacgaactcgggccgtcgaacatccgcgtcaacgccatttcggcg
ggacccgtgatgacccgcgcggcgtccgggttgaccggctttgcgggtcttctggacgcg
accgcgcgagttgccccattgcggcgcaacgtcacggccgacgaggtgggccgcgccgcc
ctgctgttcgccagcgactataccggcggcatcacgggcgaggtgctgcatgtcgatgcg
ggtgttcacgtcgaaagccctgtcgccgcagccaaaatgaacgtcaaatcggaggaatca
tga

DBGET integrated database retrieval system