KEGG   Raoultella ornithinolytica S12: TE10_00695Help
Entry
TE10_00695        CDS       T03629                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00250  Alanine, aspartate and glutamate metabolism
ron00410  beta-Alanine metabolism
ron00640  Propanoate metabolism
ron00650  Butanoate metabolism
ron01100  Metabolic pathways
ron01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TE10_00695
   00650 Butanoate metabolism
    TE10_00695
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TE10_00695
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TE10_00695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ron01007]
    TE10_00695
Enzymes [BR:ron01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TE10_00695
Amino acid related enzymes [BR:ron01007]
 Aminotransferase (transaminase)
  Class III
   TE10_00695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJF70662
UniProt: A0A0B5IJJ7
LinkDB All DBs
Position
complement(133787..135052)
Genome map
AA seq 421 aa AA seqDB search
MKNNDLNQRRQQATPRGVGVMCDFYAQKAENATLWDIEGREFIDFAAGIAVLNTGHRHPK
VVAAVASQLEAFTHTAYQIVPYASYVTLAERINALVPVSGAVKTAFFSTGAEAVENAVKI
ARAWTRRPGIITFGGAFHGRTYMTMALTGKVAPYKIGFGPFPGSVFHAQYPNALHGISSE
EAIKSLERLFKADIAADQVAAIVIEPVQGEGGFNAAPAGFMQALRALCDTHGILLIADEV
QSGFGRTGKLFAMEHYGVQPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIAEEQLCQRANELGHHLVEVLNQAKASCPQIAEVRAQGSMVAVEFFD
PQTGEPSSEFTQTVQRRALAEGLLLLTCGVYGNVIRFLYPLTIPDAQFRQALAIIQRALA
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgatcttaatcagcgtcgacagcaggcgacgccgcgcggcgtgggcgtc
atgtgcgacttctacgcgcaaaaggccgagaacgcgacgctgtgggatatcgaaggccgg
gagtttatcgattttgcggcggggattgcggtgctcaacaccgggcatcgacaccccaaa
gttgtcgccgcggtggcctcgcagctggaggcttttacccatacggcctatcagattgtc
ccctacgccagctacgtcacgctggccgaacgcattaacgctttggtgccggtctccggc
gccgtcaaaacggccttcttctccaccggcgcggaagcggtagagaatgcggtcaaaatt
gcccgcgcctggacccgtcgtccgggaatcatcacctttggcggcgctttccacggccga
acctacatgacgatggcgctgaccggcaaggtggcgccctataaaatcggcttcggtccg
ttcccgggctccgttttccacgctcagtatcccaatgcgctgcacggcatcagcagcgaa
gaggcgataaaaagcctcgagcgcctctttaaggccgacatcgcggcagatcaggtggcg
gccatcgtcattgagccggtacagggcgagggcgggttcaacgctgcgcctgccgggttt
atgcaggcgctgcgcgcgctctgtgatacccacggcatcctgctgattgcggatgaggtg
cagtccgggtttgggcgaaccggcaagctgtttgcgatggaacactatggcgtgcagccc
gacctgataacgatggcgaaaagcctggcgggcgggatgccgctgtcggcggtggccggg
cgggcggaggtgatggatgctcccgcgccaggcggcctcggcggcacctatgccggcaac
ccgctggcgattgccgccgcgcacgcggtgctggatgtgattgccgaagagcagctttgc
cagcgggcaaatgagcttggccaccatctggttgaagtcctcaatcaggccaaagcgtcg
tgcccgcagattgccgaggtgcgggcgcaggggtcgatggtggcggtcgagttttttgat
ccgcaaaccggcgagccgtcgagcgaattcacccagaccgtccagcgacgcgcgctggct
gaagggctgctgctgctgacctgcggcgtttacggcaacgtcatccgcttcctctatccg
ctcaccatccccgatgcgcaattccgccaggcgctggcgattattcagcgcgcgctggcc
gcatag

DBGET integrated database retrieval system