KEGG   Raoultella ornithinolytica S12: TE10_01375Help
Entry
TE10_01375        CDS       T03629                                 

Definition
(GenBank) xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00040  Pentose and glucuronate interconversions
ron00053  Ascorbate and aldarate metabolism
ron01100  Metabolic pathways
ron01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TE10_01375
   00053 Ascorbate and aldarate metabolism
    TE10_01375
Enzymes [BR:ron01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     TE10_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_114 Methyltransf_11 PRMT5_TIM
Motif
Other DBs
NCBI-ProteinID: AJF70793
UniProt: A0A0B5IMI6
LinkDB All DBs
Position
293531..294391
Genome map
AA seq 286 aa AA seqDB search
MRNHPLGIYEKALSKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLEWTTAQRASLVE
AMLETNVSIPSMCLSAHRRFPFGSRDEAVRERARDIMTKAIKLARDLGIRTIQLAGYDVY
YEEHDAGTQQRFAEGLAWAVEQAAGAQVMLAVEIMDTAFMNSITKWKKWDQLLASPWFTV
YPDVGNLSAWGNDVPAELALGIDRIAAIHLKDTQPVTETSPGQFRDVPFGEGCVDFVNVF
STLQNLNYRGAFLIEMWTEKAKEPVLEIIQARRWIEARMEEGGFVC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaccatccgttaggtatttatgaaaaagcgttatcgaaagacctatcctggccg
gagcgtctggttctggctaaaagctgcggattcgacttcgtggaaatgtccgtcgacgaa
accgacgagcgcctgtctcgactcgaatggactaccgcccagcgcgcctcgttagtagaa
gcgatgctggaaaccaatgtatcgattccctcgatgtgcctttccgcacatcgccgtttt
ccgttcggcagccgtgacgaagccgtacgtgagcgcgccagagacatcatgaccaaagcc
atcaagctggcgcgcgatttgggtatccgcaccatccagctcgccggttacgacgtctat
tacgaagaacacgacgcgggcactcagcaacgcttcgctgaagggctggcgtgggccgtt
gaacaggccgcaggtgctcaggtgatgctagccgtggagatcatggacaccgcatttatg
aactccatcaccaagtggaaaaaatgggaccagctgctcgcttcgccgtggttcaccgtc
tacccggacgtgggcaacctcagcgcctggggtaatgacgtcccggcagagctggctctg
ggcatcgaccgcatcgccgccattcatctgaaagacacgcagccggtcaccgaaaccagc
ccaggtcagttccgtgatgtgccgtttggtgaaggatgcgttgatttcgtcaatgtcttc
agcacattacagaacctgaactatcgcggtgcatttctgattgagatgtggaccgaaaaa
gccaaagagccggtactggaaatcattcaggcccgtcgctggattgaagcccgtatggag
gaaggaggattcgtatgttag

DBGET integrated database retrieval system