KEGG   Raoultella ornithinolytica S12: TE10_07905Help
Entry
TE10_07905        CDS       T03629                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ron00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TE10_07905
Enzymes [BR:ron01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TE10_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434
Motif
Other DBs
NCBI-ProteinID: AJF75222
UniProt: A0A0B5IX05
LinkDB All DBs
Position
1704720..1706777
Genome map
AA seq 685 aa AA seqDB search
MKKFAPLSPKVNALLHGADYNPEQWENYPDIIDQDIAMMQQANCNVMSVGIFSWAKLEPR
EGVFEFGWLDSILDKLYAAGIHVFLATPSGARPAWMSQAYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTGKINSLLAERYSRHPAVLGWHISNEYGGECHCDICQERFRDWLKARYE
TLDNLNHAWWSTFWSHTYSDWSQIESPSPQGEVSIHGLNLDWHRFNTAQVSDFCRHEVAP
LKAANADLPVTTNFMEYFYDYDYWQLAKNLDFISWDSYPMWHRDKDETTLACYTAMYHDM
MRSLKGGKPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAIIDHVGHLDTRVGREVTRLGEMLSQLPEVVGCSTDAKVAIVFDQQNRWALDDA
QGPRNMGMEYENTVNEHYRPFWEQGIAVDIIDADVDLSPYRLVIAPMLYMVRDGFAERAE
AFVAGGGHLVTTYWTGIVNESDLCHLGGFPGPLRNLLGIWAEEIDCLNDGERNLVQGLAG
NESGLQGPYQVRHLCELIHAEGAQPLATYRDDFYAGRPAVTVNRFGKGKAWHVASRNDLA
FQRDFFASISKELALPRAVDADLPPGVVATARTDGETTFVFLQNYSAQQHSVTLPQGYRD
CLSGAAADAPLSLSAWDCRILSRKA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgcgcctttgagtccgaaggttaatgcgctattgcatggtgcggactac
aacccggaacagtgggaaaactatcccgatattatcgaccaggatattgccatgatgcag
caggcaaactgcaacgtgatgtcggtaggtattttcagctgggccaaacttgaacctcgg
gaaggcgtatttgagtttggctggctggatagcattctggataagctctatgccgccggc
attcacgtatttcttgccaccccgagcggggcgcggccggcctggatgtcgcaggcctat
ccgcaggtgctgcgcgtcgggcgcgaccgcgtgccggcgctgcacggcgggcggcacaac
cactgcatgagctcgccggtataccgggaaaagaccggcaaaataaacagcctgctggcg
gagcgctattcacggcatccggcggtgctgggctggcatatttccaacgaatacggcggc
gagtgccactgcgatatctgccaggagcgcttccgcgactggctgaaggcgcgctatgag
acgctggataatctcaaccatgcctggtggagcaccttctggagccacacctatagcgac
tggtcgcagattgaatctccgtccccgcagggggaggtctccatccacggcctcaacctc
gactggcatcgctttaataccgcgcaggttagcgatttttgtcgccatgaagttgccccg
ctgaaagcggcaaatgccgacctgccggtgaccacaaactttatggaatatttctacgat
tacgactactggcagctggcaaaaaacctcgatttcatctcctgggatagctacccgatg
tggcatcgcgacaaggatgagacgacgctggcctgctacaccgcgatgtatcacgacatg
atgcgtagcctgaagggcggtaagccgtttgtgctgatggaatcgacgccgagcgcaacc
aactggcagccgaccagcaagctgaaaaagccgggcatgcacattctctcctccctgcag
gcggtggcccacggcgcggattcggtgcagtacttccagtggcgcaagagccggggttcg
gtggagaaattccacggcgcaattatcgatcacgtcgggcaccttgatacccgcgtcggc
cgggaagtgacccggctgggtgagatgctgagccagctgccggaggtggtgggctgtagc
accgatgccaaagtggcgatcgttttcgatcagcaaaaccgctgggcgttggacgatgcc
caggggccgcgcaatatgggtatggagtatgaaaataccgttaacgagcactaccgcccg
ttctgggagcagggcattgcggtggatatcatcgatgccgatgtcgatttaagcccctat
cggctggtgattgcgccgatgctctatatggttcgcgacggctttgccgagcgcgccgaa
gcgttcgttgccggcggtggtcatctggtgaccacctactggaccgggattgtaaacgag
agcgatctttgccacctcggcggcttcccgggcccgctgcgcaacctgctgggaatttgg
gcggaggagattgactgcctgaatgacggcgaacgtaatctggttcaggggctggcgggc
aatgagagcggcctgcagggcccttatcaggtgcgccacctctgcgaactgatccacgct
gagggcgcgcagccgctggcgacctatcgggatgatttctacgccgggcggccggcggtg
accgttaaccgctttggcaaaggcaaggcctggcacgtggcgtcgcgcaacgacctggct
ttccagcgcgatttcttcgcctcgataagcaaagagctggcgctgccgcgggccgtcgat
gctgatttgccgccgggcgtcgtggcaacggcgcgtaccgacggcgaaacgacctttgtg
ttcctgcaaaactacagcgcccagcagcatagcgtgacgctcccgcagggctatcgcgac
tgcctctccggcgccgcggctgatgcgcctctgagcctgagcgcctgggattgccgcatc
ctcagccgcaaagcgtaa

DBGET integrated database retrieval system