KEGG   Raoultella ornithinolytica S12: TE10_10595Help
Entry
TE10_10595        CDS       T03629                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00061  Fatty acid biosynthesis
ron01100  Metabolic pathways
ron01212  Fatty acid metabolism
Module
ron_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TE10_10595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ron01004]
    TE10_10595
Enzymes [BR:ron01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     TE10_10595
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     TE10_10595
Lipid biosynthesis proteins [BR:ron01004]
 Fatty acid synthase
  Component type
   TE10_10595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AJF72487
UniProt: A0A4R2Y186
LinkDB All DBs
Position
complement(2303979..2304497)
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPSMLMMDRVIKMSETGGNYDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRVVNRRLIMGLADGEVLVDDRLIYTAADLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacgaaagaagaccttcttgcctctggccgtggtgaa
ctgtttggcgcaaaaggcccgcagctgcccgcgccaagtatgctgatgatggaccgcgtc
atcaaaatgagcgaaaccggtggcaactacgataaaggttatgtcgaagcagaactcgat
atcaacccggacctgtggttcttcggttgccactttatcggcgatccggtgatgccaggc
tgtctgggcctggacgcaatgtggcagctcgtcggcttctatctgggctggctcggcggc
gaaggcaaaggccgcgcgctgggcgtaggtgaagttaaattcaccggtcaggtactgccg
actgcgaagaaagtgacctatcgtattcactttaaacgcgttgttaaccgtcgtctgatt
atgggcctggcggatggtgaagtactggttgacgatcgtctgatctacaccgcagccgat
ctgaaagtgggcctgttccaggacacttctgctttctga

DBGET integrated database retrieval system