KEGG   Raoultella ornithinolytica S12: TE10_13630
Entry
TE10_13630        CDS       T03629                                 

Definition
(GenBank) hypothetical protein
  KO
K11208  GST-like protein
Organism
ron  Raoultella ornithinolytica S12
Brite
KEGG Orthology (KO) [BR:ron00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    TE10_13630
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2
Other DBs
NCBI-ProteinID: AJF73041
LinkDB
Position
2962024..2962641
AA seq 205 aa
MITVYGVPGWGSAISELMLTLAEIPYHFVNVEGFDKPGPQRDSLIQINPLCQVPTLKLAD
DSVMSESAAIALTILDQRPDLAPEPGTPQRHPFQRLLIWLVANVYPTFTYADYPERWAAD
APQQLRENCVNYRQSLYLWLEQQLVAGPYALGERISLLDCYIAVMCSWRPGREWFEAHTP
KFVAVADAVYQRAELEAVLRRNELI
NT seq 618 nt   +upstreamnt  +downstreamnt
atgatcaccgtctatggcgtaccgggctgggggtcggcaatcagcgagctgatgctgacg
ctggccgaaatcccgtaccactttgttaacgttgagggttttgataaacccggaccgcag
cgcgacagcctgatacagataaacccgctgtgtcaggtacccacccttaagctggcggac
gacagcgtgatgagcgaatctgccgcgattgccttaaccatcctcgaccagcggccggac
ctcgcgcccgagccaggaacgccgcagcgacacccgtttcagcgcctgctgatttggttg
gttgccaacgtctatcccaccttcacctacgcggattaccctgagcgctgggcggctgat
gcaccgcagcagctgcgggaaaactgcgtgaactatcgccagtcgctctacctgtggctt
gagcagcagctcgtcgccgggccctacgcgctgggcgagcggataagcctgctggactgc
tatatcgcggtcatgtgctcgtggaggccggggcgggagtggtttgaagcgcacacgccg
aaattcgtcgccgtcgcggatgcggtatatcaacgcgccgagctggaggcggtattacgc
cgcaacgagctgatttaa

DBGET integrated database retrieval system