KEGG   Raoultella ornithinolytica S12: TE10_14080Help
Entry
TE10_14080        CDS       T03629                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00550  Peptidoglycan biosynthesis
ron01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TE10_14080
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    TE10_14080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ron01011]
    TE10_14080
Enzymes [BR:ron01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TE10_14080
Peptidoglycan biosynthesis and degradation proteins [BR:ron01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   TE10_14080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJF73126
UniProt: A0A0B5IKZ8
LinkDB All DBs
Position
3064100..3066025
Genome map
AA seq 641 aa AA seqDB search
MTLLRDEIRDHSAEEMLFIRRAVVAFILVVVCFSILIVNLYRLQVRQHDFYQTRSNQNDI
KMLPIAPSRGLIFDRNGVPLVQNITLYRLQVIPSKIADMKALLQQLTPIVDLTPDDIAGF
RDDMLHNSRYKEVTLKSALSDVEVARFAVNEFRFPGVTVENYQQRDYPYGAELAHVVGYV
SKINDSDLQRLAKNGEAENYAADHNIGKQGIEGYYEQELHGTTGYQEVEVDNHGRVVRLL
KEVPPVAGKNIYLTLDLHLQQYIESVLKGQRAAVVAVDPRDGGVLAMVSSPSYDPNPFVK
GIGYKAYRSLLDNADRPLINRVTQGLYPPASTVKPYMALSALSAGVITPTTTFFGAPTWT
LPGTQRRYRDWLKTGHGMLNVTKAIEESADTFFYQVAFEMGIDRIHTWLSKFGYGQPTGI
DLNEEYSGVLPSREWKQRIHKKPWYQGDTISVGIGQGYWIATPIQMVKALTTLINNGKVK
NPHLLYSMKRGNKVERYQPPQNTPQVGDPKSPYWGIVRNGMYGMANLPNGTGYKLFHTAP
YQIAAKSGTSQVFSLKENQTYNAKMIPVRLRDHIFYTLFAPYQHPRVAMALILENGGGDG
VVAGPTARAILDHIFDPANAPAAAEGGAQANVPQVDSADAQ
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgactctattgagagatgaaattcgcgatcactcagcggaagagatgctgtttattcgc
cgggccgtggtggcttttatcctggtggtggtctgctttagcatactgatcgtcaacctc
tatcgcctccaggtcaggcagcacgatttctatcagacccgctcgaaccagaacgatatt
aaaatgctgccaatcgcgccgagccgcgggctgatattcgatcgcaacggcgttccgctg
gtccagaacatcaccctctatcgcctgcaggtgatccccagcaaaatcgccgacatgaaa
gcgctgctgcagcagctgacgccgatcgttgatttaacccccgatgatatcgccggcttc
cgcgacgatatgctgcacaacagccgctacaaagaggtgacgctaaaatccgcgctcagc
gacgtcgaagtggcgcgctttgcggtcaacgaattccgtttccccggcgtcaccgtggag
aactaccagcagcgtgactacccttacggcgccgagctggcgcacgttgtcggctacgtc
tcgaaaattaacgatagcgatctgcagcggctggccaaaaacggcgaggccgagaactat
gccgccgaccacaatatcggcaagcagggtattgagggctattacgaacaggagctgcac
ggtaccaccggctaccaggaggtcgaggtggataaccacgggcgggtggtgcggctgctg
aaagaggtgccgccggtcgccggcaaaaatatctatctgacgctggatctgcaccttcag
cagtacattgaatcggtgctcaaggggcagcgcgcggcggtggtggcggtcgacccgcgc
gacggcggggtgctggcgatggtttccagcccgagctacgatcccaatccctttgtgaaa
ggcattggctataaggcctaccgttcgctgctcgataacgccgaccggccgctgattaac
cgcgtcacccaggggctctacccgccggcgtcgacggttaaaccctatatggcgctctcg
gcgctctcggccggggtcattacgcccaccaccaccttcttcggcgcgccgacctggacg
ctgcccggcacccagcgccgctaccgcgactggctgaaaaccggtcacggcatgctcaac
gttaccaaggccattgaagagtcggcggataccttcttctatcaggtggcgtttgagatg
gggatcgaccggattcacacctggctgagcaagtttggctacggccagccaaccgggatc
gacctcaatgaagagtattcgggggtgctgccgagccgcgaatggaagcagcggattcat
aagaagccgtggtatcaaggggataccatctcggtcggcatcggccagggctactggatt
gccaccccgatccagatggtgaaagcgctgacgacgctgatcaacaacggcaaggtgaag
aacccgcatctgctttactccatgaagcgcggcaataaagttgagcgctatcagccgccg
caaaacacgccgcaggtgggcgatccgaaatcgccgtactgggggattgtgcgcaacggg
atgtacggcatggccaacctgccaaacggcaccggctacaagctgttccacaccgcgccg
tatcagattgccgcgaagtccgggacctcgcaggtcttcagcctgaaggagaaccagacc
tacaatgcgaaaatgatcccggtcaggctgcgtgaccacattttctataccctgtttgcc
ccgtatcagcatcctcgggtggcgatggcgctgatccttgagaacggcggcggcgacggc
gtggtggcaggacctacggcgcgcgccattcttgatcatatcttcgacccggctaacgcg
ccggcggcggcagagggcggcgcgcaggctaacgtccctcaggtcgatagcgccgacgcg
cagtag

DBGET integrated database retrieval system