KEGG   Raoultella ornithinolytica S12: TE10_21185Help
Entry
TE10_21185        CDS       T03629                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00521  Streptomycin biosynthesis
ron00562  Inositol phosphate metabolism
ron01100  Metabolic pathways
ron01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TE10_21185
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TE10_21185
Enzymes [BR:ron01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     TE10_21185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AJF74405
LinkDB All DBs
Position
4618420..4619223
Genome map
AA seq 267 aa AA seqDB search
MHPMLNIAVRAARKAGNLIAKHYETPDSVETSQKGSNDFVTNVDKAAEALIIETIRKSYP
QHTIITEESGEHVGEDQDVQWVIDPLDGTTNFVKRLPHFSVSIAVRIKGRTEVAVVYDPM
RNELFTATRGQGAQLNGYRLRGSTARDLDGTIIATGFPFKAKQHATTYMNILGKMFTECA
DFRRTGSAALDLAYVAAGRVDGYFEIALKPWDFAAGELIAREAGAIVCDFTGGHNHLYSG
NIVAGNPRVVKAMLANMREELSEALKR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgatgctgaatatcgccgtgcgcgcagcgcgcaaggcgggtaatttaattgcc
aagcactacgaaaccccagactccgtagaaaccagccagaaaggcagcaatgattttgtg
actaacgtcgataaggcagccgaagcgctgattattgaaacgattcgcaaatcttacccg
cagcacactattatcaccgaagaaagcggtgagcacgtaggtgaagatcaggatgttcaa
tgggttatcgatccactggatggcaccaccaacttcgtaaaacgcctgccgcacttctcc
gtatccatcgccgtacgcattaaaggccgtaccgaagtcgccgtggtttacgatccaatg
cgcaacgaactcttcaccgcaacccgcggccagggcgctcagctgaacggctatcgtctg
cgcggcagcaccgctcgcgatctggatggtacgattatcgctaccggtttcccgttcaaa
gcgaaacagcacgccaccacttatatgaatattctgggcaaaatgtttaccgaatgcgct
gacttccgccgcaccggttctgctgctctggatctggcctacgttgccgccggccgcgtt
gatggctacttcgagatcgcgctgaagccgtgggatttcgctgctggcgagctgatcgct
cgtgaagcgggcgctatcgtttgcgacttcaccggtggccataaccacctgtacagcggc
aacatcgttgccggcaacccgcgcgtcgttaaagccatgctggccaacatgcgtgaagag
ctgagcgaagcgctgaagcgttaa

DBGET integrated database retrieval system