KEGG   Rhodococcus opacus B4: ROP_07760Help
Entry
ROP_07760         CDS       T00882                                 

Definition
(GenBank) putative succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00020  Citrate cycle (TCA cycle)
rop00190  Oxidative phosphorylation
rop00650  Butanoate metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
Module
rop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rop_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_07760
   00650 Butanoate metabolism
    ROP_07760
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ROP_07760
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ROP_07760
    1.3.5.4  fumarate reductase (quinol)
     ROP_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 Pyr_redox_3 AlaDh_PNT_C FAD_oxidored GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAH49023
NITE: ROP_07760
UniProt: C1AU15
LinkDB All DBs
Position
complement(808542..810476)
Genome map
AA seq 644 aa AA seqDB search
MTEVERHQYDVVVIGAGGAGLRAVIEAREQGLSVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANDKDTWQTHFQDTMRGGKFLNNWRMAELHAREAPDRVWELETYGALFDRTPDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDFAATGDYEARIKIFAECTISELTKD
GDRISGAFGYWRESGRFVLFEAPAVVMATGGIGKSFKVTSNSWEYTGDGHALALRAGANL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSEGERFMFSYIPPVFKGQYAETE
EEADGWYEDSDNNRRTPDLLPRDEVARAINSEVKAGRQTPHGGVYLDIASRMPADEIVRR
LPSMYHQFKELADVDITKEQMEVGPTCHYVMGGIEVDPDSGSSSVAGLFAAGECSGGMHG
SNRLGGNSLSDLLVFGRRAGLGAAEYVKSLQERPAVSAAAVDAAARMLLSPFDPSVEEGG
TTENPYTLHTELQQTMNDLVGIIRKEDEIARALEKLTEIKGRIGGVEVEGHRQFNPGWHL
AVDLRNMVLVSECVAQAALLRTESRGGHTRDDHPNMEADWRNTLLVCSVVGDMSAHPDSV
VPDVTVTREPQLPMRPELLELFDIDELAKYYTDAELAEHPGRKA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagtcgaacggcaccagtacgacgtcgtggtcatcggtgccgggggcgccgga
ctgcgagccgtcatcgaggcccgcgagcagggcctgtccgtcgcagtcgtctgcaagtcg
ctgttcggcaaggcgcacaccgtcatggccgagggcgggtgcgccgccgcgatgggaaac
gccaacgacaaggacacgtggcagacccattttcaggacacgatgcgcggcggcaaattc
ctcaacaactggcggatggccgaactgcacgcccgcgaggcccccgaccgggtgtgggaa
ctcgaaacgtacggcgccctgttcgaccggacccccgacggccggatcagccagcgcaac
ttcggcggtcacacgtatccgcggctcgcgcacgtcggtgaccgcaccggcctcgaactg
atccgcaccatgcagcagaagatcgtgtcgctgcagcaggaagacttcgccgccaccggc
gactacgaggcccgcatcaagatcttcgccgagtgcaccatctccgagctcaccaaggac
ggcgaccggatctcgggcgccttcggatactggcgcgagagtggacgtttcgtcctgttc
gaggcgcccgccgtggtgatggccacgggcggaatcggcaagtcgttcaaggtgacgtcg
aactcgtgggagtacaccggcgacggtcacgccctcgccctccgcgcgggcgccaacctc
atcaacatggaattcgtgcagttccaccccaccggcatggtgtggccgcccagcgtcaag
gggatcctcgtgaccgagggtgtccgcggcgacggcggggtactgaagaactccgagggc
gagcggttcatgttctcgtacatcccgccggtcttcaaaggccagtacgcggagaccgag
gaggaggccgacggctggtacgaggactccgacaacaaccgccgcaccccggacctgctg
ccccgcgacgaggtggcccgcgccatcaactccgaggtcaaggcaggcaggcagaccccg
cacggcggcgtgtacctcgacatcgcctcgcggatgcccgccgacgagatcgtgcggcgc
ctgccgtcgatgtaccaccagttcaaggaactcgcggacgtcgacatcaccaaggagcag
atggaggtcggaccgacctgtcactacgtgatgggcggcatcgaggtcgaccccgacagc
ggatcgtccagcgtcgccgggttgttcgccgcgggggagtgctcgggcggaatgcacggt
tccaaccggctcggcggcaactcgctgtccgacctcctcgtgttcgggcgtcgcgcgggg
ctcggggccgcggaatacgtgaagtcgctgcaggagcggcccgccgtctcggcggccgcc
gtggacgcggcggcacggatgttgttgtcgccgttcgatccgtcggtcgaggagggcggc
accaccgagaacccgtacaccctccacaccgaactgcagcagaccatgaacgacctcgtc
ggcatcatccggaaggaagacgagatcgcgcgcgccctggagaaactcaccgagatcaag
ggccggatcgggggcgtcgaggtggaggggcaccgacagttcaatcccggctggcacctc
gccgtggacctgcggaacatggtgctggtcagcgaatgcgtcgcgcaggcggccctgctg
cgcacggaaagtcgcggcgggcacacccgcgacgaccacccgaacatggaggcggactgg
cgcaacaccctgctggtgtgcagcgtggtcggcgacatgtccgcgcaccccgattccgtg
gtcccggacgtcacggtcacccgcgagccccagctcccgatgcgaccggaactgctggag
ctgttcgacatcgacgaactggccaagtactacaccgacgccgaacttgcggaacatccg
ggaaggaaggcctga

DBGET integrated database retrieval system