KEGG   Rhodococcus opacus B4: ROP_13310Help
Entry
ROP_13310         CDS       T00882                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ROP_13310
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ROP_13310
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ROP_13310
    1.1.1.-  
     ROP_13310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: BAH49578
NITE: ROP_13310
UniProt: C1AX74
LinkDB All DBs
Position
1405815..1406870
Genome map
AA seq 351 aa AA seqDB search
MRAARFHGRRDIRIDDIPEPELRPGAVKLRVAWCGICGTDLHEYLEGPIFISPPGHPHPL
SHENAPVTMGHEFSGTVEEVGEGVTDVAVGDNVVVEPYFVCNECASCRASNYHLCTKMGF
IGLAGGGGGLSEKVVVDRRWVHKIGDIPLDEAALIEPLSVAHHAVVRSGAKAGDVALVGG
AGPIGLLVAAVLKGLGVTTIVTELSDARKQKALSSGVAHHVVDPSSEDVKARVLELTDGV
GADLGFECAGVNAVLDTILDAVRPAAVVVNVSIWGKPATVDMQKLVLKEIDLRGTIAYVR
DHEAVIEMVRSGVIDLAPFITGRIELDNLVSDGLTTLIEHNDTAVKILVRA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagcacgcttccacggacgacgcgacatccggatcgacgacatccccgagccg
gaactgcggccgggcgcggtgaaactccgggtcgcgtggtgcggcatctgcggcaccgac
ctccacgagtacctcgagggcccgatcttcatctccccgccgggacatccgcatccgctg
tcgcacgagaacgccccggtgacgatgggccacgagttctccgggacggtggaggaggtc
ggcgagggcgtcaccgacgtcgcggtgggcgacaacgtggtggtggagccgtacttcgtg
tgcaacgagtgcgcgtcctgcagggcaagcaactatcacctgtgtacgaagatgggtttc
atcggattggccggtgggggaggcggactcagcgagaaggtggtggtcgaccgccgctgg
gtgcacaagatcggcgacatcccgctcgacgaggcggccctgatcgaaccgctcagcgtc
gcgcatcatgcggtcgtccgcagcggggcgaaggccggcgacgtcgcgctggtcggcggt
gcggggccgatcggactcctggtggccgcggtcctgaagggtctgggtgtcaccacgatc
gtcacggaactcagtgacgcccggaagcagaaggcactgtcgagcggggtcgcgcaccac
gtcgtcgacccgtcgtccgaggacgtgaaagcgcgtgtgctcgagttgaccgacggtgtc
ggcgccgacctcggattcgaatgcgcgggggtcaacgccgtcctcgacaccatcctcgac
gccgtccggcccgcggcggtcgtggtgaacgtgtcgatctggggcaagccggcgacggtc
gacatgcagaagctcgtcctcaaggagatcgatctgcgcggcaccatcgcttacgtccgc
gatcacgaggcggtgatcgagatggtgcgcagcggggtgatcgacctggccccgttcatc
accggccggatcgaactcgacaacctggtctccgacggcctcacgacgttgatcgagcac
aacgacacggcggtgaagatcctggtccgggcgtga

DBGET integrated database retrieval system