KEGG   Rhodococcus opacus B4: ROP_27470
Entry
ROP_27470         CDS       T00882                                 

Definition
(GenBank) putative 2,6-dihydroxypseudooxynicotine hydrolase
  KO
K19188  2,6-dihydroxypseudooxynicotine hydrolase [EC:3.7.1.19]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00760  Nicotinate and nicotinamide metabolism
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
Module
rop_M00810  Nicotine degradation, pyridine pathway, nicotine => 2,6-dihydroxypyridine/succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ROP_27470
Enzymes [BR:rop01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.19  2,6-dihydroxypseudooxynicotine hydrolase
     ROP_27470
SSDB
Motif
Pfam: DUF1100 Peptidase_S9 Abhydrolase_1 Hydrolase_4 BAAT_C Esterase DLH UPF0227
Other DBs
NCBI-ProteinID: BAH50994
NITE: ROP_27470
UniProt: C1B568
LinkDB
Position
2955818..2956915
AA seq 365 aa
MSSQPPVLTPEHEMLNWGRLILDGVPYADIVGARDRPSDQGWFEYWMSRADDYESLGDEC
VSAAHTLSAGEYFYLAAICVQYAQFLWFDDKRAHGQRRKVELYRKAAPYLKPAAELVELS
VDGTPMPVFLRVPDGAGPHPVVVLLGGLESTKEESRLMEDLLLSRGMATATFDGPGQGEM
FVHRELSGDFERYTSTVIDYLVSRDDLQSDAVGVLGRSLGGNYALKSAACDERVAACVCW
GGFADMDSWDTETPMTMESWRYVSKVKTLDEAHVHVHQALETRDVLEQLTCPTYVLHGML
DEIPSAFLETLRQHAVNAPLTIVVEDEGDHCCHNLGPRPRFQMADWLADHLVTPDDSPAK
EHADG
NT seq 1098 nt   +upstreamnt  +downstreamnt
ttgtcctcgcagcctccggtcttgacgccggaacacgagatgctgaactggggccgtctg
atcctggatggtgtcccctatgccgacatcgtcggtgctcgcgaccgaccatcggaccag
ggctggttcgaatactggatgtcacgggcggacgactacgagagcctcggcgacgagtgc
gtaagcgcagcgcacaccctctctgcgggcgaatacttctacctcgctgccatctgcgtg
cagtacgcgcaattcttgtggttcgacgacaagcgcgcgcacggccaacggcggaaggtc
gagctctaccggaaagcggcaccgtacctgaagccggcggccgagctggtcgaattgtcg
gtggacgggacgccgatgccggtgtttctccgcgtgccggacggcgccggtccgcacccg
gtggtggtgttgctgggcggcctcgagagcaccaaggaggagagccgtttgatggaagac
ctcctcctctcacgcggaatggcaaccgccacgttcgacggccccgggcagggtgaaatg
ttcgtacaccgagagctttccggtgatttcgagcgctacacctccaccgtgatcgactac
ctcgtctcgcgagacgacctgcaatccgacgcggtcggtgtcctcgggcgcagcttgggc
ggaaactatgcgctcaagtccgctgcgtgtgacgagcgtgtcgccgcatgcgtgtgctgg
ggtgggttcgcggacatggattcgtgggacaccgagactcccatgacaatggagagttgg
cgctacgtcagcaaggtgaagaccctcgacgaggcgcacgtgcacgtccaccaggctttg
gagactcgagacgtcctcgagcagttgacgtgtccgacctatgtgcttcacgggatgctc
gacgagattccttccgcttttctcgagaccctgcgtcagcacgccgtcaatgccccgctg
acgatcgtggtcgaggacgaaggcgaccactgctgtcacaatcttggtccgcggccccgg
ttccagatggcggactggcttgcagaccatctggtcacccctgacgattcaccggcgaag
gagcacgcagatgggtga

DBGET integrated database retrieval system