KEGG   Rhodococcus opacus B4: ROP_27910Help
Entry
ROP_27910         CDS       T00882                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rop  Rhodococcus opacus B4
Brite
KEGG Orthology (KO) [BR:rop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ROP_27910 (ahpF)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ROP_27910 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO Glutaredoxin K_oxygenase FAD_binding_3 Thi4 FMO-like NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAH51038
NITE: ROP_27910
UniProt: C1B5B2
LinkDB All DBs
Position
3004966..3006558
Genome map
AA seq 530 aa AA seqDB search
MLEASLAGQLKSLLERLTLPIELVSSLDDGPKSTELAELLTEIAAMSDKVTYERRDDDAR
RPSFAVRRSGTDIEVRFAGIPLGHEFTSLALALLQVGGYPSKESPELLEQVRNLDGDFHF
ETYFSLSCQNCPDVVQALNLMAVLNPRISHVAIDGALFQDEVDGRQIMAVPTVFVNGELF
GSGRMSLEEIIGKLDVGAADRAATAIAQKDPFDVLVVGGGPSGAAAAVYAARKGIRTGIA
AERFGGQVLDTMAIENFISVPYTEGPQFGSALENHVRQYGVDIMNTQKAAKLVPAATENG
LVEIELESGASLLARTVILSTGARWRSMNVPGEDAYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLVEHVTLIEFDSVLRADEVLQRKLRSLPNADILLSTLTTEVVGDG
GKVTGLAYQDRTTDTAHTLDVEGVFVQIGLLPNTEWLAGSVELSDRGEIAIDDRGQTSVP
GVFAAGDCTTVPYKQIVIAAGAGATAALSAFDRLIRTGVPAEESAAATVG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagcctcgctcgccggccaactcaagtccctcctcgaacggctgaccctgccg
atcgagctcgtctcctcgctcgacgacggtcccaagtccaccgaactcgccgaactgctc
accgagatcgcggcgatgtcggacaaggtcacctacgaacgccgtgacgacgacgcgcgg
cgcccgtccttcgccgtccgccgcagtggcaccgacatcgaggtccgcttcgccggaatc
ccgctcggccacgaattcacgtcgctcgcactcgctttactccaggtcggcggctacccg
tcgaaggagtcccccgaactgctcgagcaggtccgcaacctcgacggcgacttccacttc
gagacctacttctcgctgtcctgccagaactgccccgacgtggtgcaggccctgaacctc
atggccgtgctcaatccgcgcatcagccacgtggcgatcgacggcgccctcttccaggac
gaggtcgacggccgccagatcatggccgtgccgacggtcttcgtcaacggcgaactcttc
ggctccggccggatgagcctcgaggagatcatcggcaagctcgacgtcggcgcagccgac
cgcgcggccaccgcgatcgcgcagaaggatccgttcgacgtcctcgtggtcggaggtggc
ccgtccggtgccgccgccgcggtgtacgccgcgcgcaagggaattcgcaccggcatcgcc
gccgaacgcttcggcggccaggtgctcgacaccatggcgatcgagaacttcatctccgtt
ccctacacggagggcccccagttcgggtctgcactcgaaaatcacgtccgccagtacggc
gtcgacatcatgaacacgcagaaggccgcgaagctcgtgcccgccgccaccgagaacggt
ctcgtcgagatcgaactggaaagcggtgcttcccttctcgcgcgcacggtgatcctgtcg
acgggtgcacggtggcgctcgatgaacgtgcccggcgaggacgcgtaccggaacaagggt
gtcacctactgcccgcactgcgacggaccgctgttcaagggcaagcgcgtcgccgtgatc
ggtgggggcaactccggagtggaggccgcgatcgacctcgccggactggtcgagcacgtc
acgctcatcgagttcgactcggtgctccgcgccgacgaggtgctgcagcgcaaactccgc
agcctccccaacgcggacatcctcctgagcacgctcacgacggaggtcgtcggagacggc
ggcaaggtcaccggcctggcgtaccaggaccgcacgaccgacaccgcgcacacgctcgac
gtggagggtgtcttcgtccagatcggactgctgcccaacaccgagtggctggcggggagc
gtcgagctgtccgatcgcggcgagatcgcgatcgacgaccgcggccagacgtcggtcccc
ggggtgttcgccgccggcgactgcaccaccgttccgtacaagcagatcgtgatcgccgcc
ggagccggcgcgacggcggcgctgagcgcattcgatcggctcatccggaccggtgtgcct
gcggaggagtccgcggccgcaacggtcggatag

DBGET integrated database retrieval system