KEGG   Rhodococcus opacus B4: ROP_44590Help
Entry
ROP_44590         CDS       T00882                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00250  Alanine, aspartate and glutamate metabolism
rop00410  beta-Alanine metabolism
rop00640  Propanoate metabolism
rop00650  Butanoate metabolism
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
Module
rop_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ROP_44590 (gabT)
   00650 Butanoate metabolism
    ROP_44590 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ROP_44590 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROP_44590 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rop01007]
    ROP_44590 (gabT)
Enzymes [BR:rop01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ROP_44590 (gabT)
Amino acid related enzymes [BR:rop01007]
 Aminotransferase (transaminase)
  Class III
   ROP_44590 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAH52706
NITE: ROP_44590
UniProt: C1BAK3
LinkDB All DBs
Position
4806854..4808095
Genome map
AA seq 413 aa AA seqDB search
MTRLSPLLAQATPVTVDHGEGCYLYGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQVG
SLIHGQYTTVMHQPMLELVDRLGSVLPPGLDSLFFANSGSEAVEASLRLSRQATGRPNII
VFHGGFHGRTVATATMTTSGTRFSAGFSPLMGGVHVAPFPNAYRYGWSEEEATAFALKEL
DYIFATLTAPNETAAFVVEPVLGEGGYVPGNTAFFQGLRERADKYGILLVIDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMAKGWPGSQGGTYGGNAVSCAA
AVATLEVIEKEDLVANAAARGIQLLEGARQKAIEGIGDVRGLGLLVGSEFTAADGSADRA
KAAAAQQLAAKKGLLLLTCGAHMNVVRMIPPLIVTSEQIEDALKIWSEVLDEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgactcggttatctccactgctcgcacaggccacacccgtgacggtcgatcacggagaa
ggctgctacctctacggcaccgacggtcgccgctatctcgacttcaccgcgggcatcggc
gtcaccagcaccgggcactgccacccgcacgtcgtggaggccgcgcgcaggcaggtcggc
tccctcatccacgggcagtacacgacggtcatgcaccagccgatgctcgaactcgtcgat
cggctggggtcggtgttgcccccgggactcgactcgctgttcttcgcgaactcgggaagc
gaggccgtggaggcgtcgctccgactgtcgcggcaggcaaccggccgccccaacatcatc
gtgttccacggcggattccacggacgcacggtcgcgacggcgaccatgaccacgtccggc
acccggttctcggccggcttcagcccgctgatgggcggcgtccacgtggccccgttcccc
aacgcctaccgctacggctggtccgaggaagaggcgacggcgttcgcgctgaaggaactc
gactacatcttcgcgacgctcaccgcgccgaacgagacggccgcgttcgtcgtcgaaccc
gtcctcggtgagggcggctacgtgcccggcaacaccgcgttcttccagggactccgcgag
cgtgccgacaagtacggcatcctgctcgtcatcgacgagatccagaccggattcggccgc
accggcaaattcttcgggcaccagcacttcgacgtccggcccgacatcattaccatcgcc
aaggggctggccagcgggttcccgctgtcgggcatcgcggcgtccgaggaactcatggcc
aagggctggccggggtcgcagggcgggacgtacggcggcaacgccgtgtcctgcgcggcc
gcggtcgcgacgctcgaggtcatcgagaaggaagacctcgtcgccaacgccgccgcccgc
ggcatccagctgctcgagggtgcgaggcaaaaggccatcgaggggatcggcgacgtccgc
ggcctcggactgctggtgggcagcgaattcaccgccgccgacggtagcgcggaccgtgcg
aaagcggctgcggcgcagcaactggccgcgaagaaggggctgctgttgttgacctgcggc
gcccacatgaacgtggtacggatgattccaccgctcatcgtcacgtcggaacagatcgag
gatgccctgaagatttggtccgaggttctcgacgaagtgtga

DBGET integrated database retrieval system