KEGG   Rhodococcus opacus B4: ROP_51680Help
Entry
ROP_51680         CDS       T00882                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
rop  Rhodococcus opacus B4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: BAH53415
NITE: ROP_51680
UniProt: C1AUS5
LinkDB All DBs
Position
5640451..5641494
Genome map
AA seq 347 aa AA seqDB search
MDLPVMPPLQPMLAKAASSVPAQPESGLAWSYEPKWDGFRVLVFRDGDEVVLGSRGGKDL
ARYFPELVRAVKDELPERCVVDGELVVPRNIDGRTRLDWESLSERIHPAESRVTMLAEKT
PAQFVAFDLLALGDRDLSREDFSVRRAQLVDTIGGGPSCHVTAATESSATATEWFEAFEG
AGLDGVVAKKLVGPYLPNKREMVKVKHARTADCVVIGYRPHKSQPGIGSMLLGLYDGDQM
AMVGGASAFTAARRIELLAELDELRVGDDVVADGAPTRWQSGNDRTWVPLRPERVVEVAY
DQMEGARFRHAARFLRWRPDRTPDECTFQQLEVPVRYDLADVLAGGS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggacctccccgtgatgcccccgttacaaccgatgctcgcgaaggctgcgtcgtccgtt
ccggcgcaaccggagtccgggctcgcctggtcgtacgaacccaaatgggacggattccgc
gtcctcgtcttccgtgacggcgacgaggtggtgctcggttcccgcggcggaaaagacttg
gcccggtactttcccgaactcgtccgcgccgtgaaggacgaactgcccgagcggtgcgtg
gtggacggcgaactcgtcgtcccgcgcaacatcgacggccgcacccgcctcgactgggag
tcgttgtcggagcgcattcatcccgcggagagccgggtgacgatgctggcggagaagacc
ccggcccagttcgtcgcgttcgatctgctggcgctgggcgaccgcgacctcagccgggag
gacttctccgtgcgccgcgcgcaactcgtcgacaccatcggcggcgggccctcctgccac
gtcaccgcggccaccgaatccagtgcgacggccaccgagtggttcgaggcgttcgagggg
gccggcctcgacggggtggtggcgaagaagctggtcggcccgtacctgccgaacaagcgg
gaaatggtgaaggtgaagcacgcccgcaccgccgactgcgtcgtcatcggataccggccg
cacaagagccagccggggatcgggtcgatgctgctcggactgtacgacggcgaccagatg
gcgatggtcggcggtgcctcggcgttcacggcggcgcgacgtatcgaactgctcgccgaa
ctcgacgaactgcgcgtcggcgacgacgtcgtcgcggacggtgcgccgacgcggtggcag
tcgggcaacgaccgcacctgggtgccgctgcgacccgaacgcgtcgtcgaggtggcgtac
gaccagatggagggtgcccggttccggcacgccgcgcggttcctgcgctggcgcccggac
cggacgcccgacgagtgcacgttccaacaattggaggtcccggtgcgatacgaccttgcc
gacgtcctggccggaggttcctag

DBGET integrated database retrieval system