KEGG   Rhodococcus opacus B4: ROP_62970Help
Entry
ROP_62970         CDS       T00882                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00020  Citrate cycle (TCA cycle)
rop00480  Glutathione metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
rop01210  2-Oxocarboxylic acid metabolism
rop01230  Biosynthesis of amino acids
Module
rop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rop_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_62970 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ROP_62970 (icd)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ROP_62970 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAH54544
NITE: ROP_62970
UniProt: C1B149
LinkDB All DBs
Position
6902077..6903300
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDETDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVPGPGKVMITYTPEDGSEPIEHELVNFPDGGGVVQ
GQYNFTKSIEDFARASLNYGLQQNYPVYLSTKNTILKAYDGAFKDIFQHVYETEFKPEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
NTCEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPDVIGFAQELE
DVVIKTVEGGQMTKDLAMLVGGDQGYLTTEEFLGTLDINLQKAIAEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgagggcaccgtcgtcgaactcgacggcgacgagatgacacgc
atcatctggcagttcatcaaagacaagctgatccatccctacctggatgtgaacctggag
tactacgacctcggtatcgagtaccgggacgagacggacgaccaggtcaccgtcgacgcg
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcaccccggacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggtggcacgatcttccgcgcgccgatcatcatctccaacgttccgcgactg
gttccgggctggacgaagccgatcatcatcggccgtcacgccttcggcgaccagtaccgc
gccaccgacttcaaggtccccggcccgggcaaggtgatgatcacctacacgcccgaggac
ggcagcgagccgatagagcacgagctggtgaacttccccgacggcggcggcgtcgtccag
ggtcagtacaacttcaccaagtccatcgaggacttcgcgcgcgcctcgctcaactacggc
ctgcagcagaactacccggtgtacctgtcgacgaagaacacgatcctcaaggcgtacgac
ggtgcgttcaaagacatcttccagcacgtctacgagaccgagttcaagccggagttcgac
gcggcgggtctcacctacgagcaccgcctcatcgacgacatggtcgcgtcggcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggcttcggttcgctcggcctcatgacctccgtgctgctgaccccggacggc
aacacgtgtgaggcggaggcggcgcacggcaccgtgacgcgtcacttccgtcagcaccag
cagggcaagccgacgtccaccaaccccatcgcgtcgatcttcgcgtggacccgtggactc
gagcaccgcggcaagctggacaacacccccgacgtcatcgggttcgcgcaggagctcgaa
gacgtggtcatcaagaccgtcgagggcggccagatgaccaaggacctcgcgatgctggtc
ggcggcgaccagggctacctcaccaccgaggagttcctcggcacgctggacatcaacctc
cagaaggccatcgcggagaagtag

DBGET integrated database retrieval system